Anti MTUS1 pAb (ATL-HPA067903)

Atlas Antibodies

Catalog No.:
ATL-HPA067903-25
Shipping:
Calculated at Checkout
$478.00
Adding to cart… The item has been added
Protein Description: microtubule associated tumor suppressor 1
Gene Name: MTUS1
Alternative Gene Name: ATBP, ATIP1, DKFZp586D1519, FLJ14295, ICIS, KIAA1288, MP44, MTSG1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000045636: 56%, ENSRNOG00000010748: 56%
Entrez Gene ID: 57509
Uniprot ID: Q9ULD2
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen STPVLEPTKVTFSVSPIEATEKCKKVEKGNRGLKNIPDSKEAPVNLCKPSLGKSTIKTNTPIGCKVRKTEIISYPRPNFKNVKAK
Gene Sequence STPVLEPTKVTFSVSPIEATEKCKKVEKGNRGLKNIPDSKEAPVNLCKPSLGKSTIKTNTPIGCKVRKTEIISYPRPNFKNVKAK
Gene ID - Mouse ENSMUSG00000045636
Gene ID - Rat ENSRNOG00000010748
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti MTUS1 pAb (ATL-HPA067903)
Datasheet Anti MTUS1 pAb (ATL-HPA067903) Datasheet (External Link)
Vendor Page Anti MTUS1 pAb (ATL-HPA067903) at Atlas Antibodies

Documents & Links for Anti MTUS1 pAb (ATL-HPA067903)
Datasheet Anti MTUS1 pAb (ATL-HPA067903) Datasheet (External Link)
Vendor Page Anti MTUS1 pAb (ATL-HPA067903)