Anti MTUS1 pAb (ATL-HPA067903)
Atlas Antibodies
- Catalog No.:
- ATL-HPA067903-25
- Shipping:
- Calculated at Checkout
$447.00
Gene Name: MTUS1
Alternative Gene Name: ATBP, ATIP1, DKFZp586D1519, FLJ14295, ICIS, KIAA1288, MP44, MTSG1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000045636: 56%, ENSRNOG00000010748: 56%
Entrez Gene ID: 57509
Uniprot ID: Q9ULD2
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | STPVLEPTKVTFSVSPIEATEKCKKVEKGNRGLKNIPDSKEAPVNLCKPSLGKSTIKTNTPIGCKVRKTEIISYPRPNFKNVKAK |
| Gene Sequence | STPVLEPTKVTFSVSPIEATEKCKKVEKGNRGLKNIPDSKEAPVNLCKPSLGKSTIKTNTPIGCKVRKTEIISYPRPNFKNVKAK |
| Gene ID - Mouse | ENSMUSG00000045636 |
| Gene ID - Rat | ENSRNOG00000010748 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti MTUS1 pAb (ATL-HPA067903) | |
| Datasheet | Anti MTUS1 pAb (ATL-HPA067903) Datasheet (External Link) |
| Vendor Page | Anti MTUS1 pAb (ATL-HPA067903) at Atlas Antibodies |
| Documents & Links for Anti MTUS1 pAb (ATL-HPA067903) | |
| Datasheet | Anti MTUS1 pAb (ATL-HPA067903) Datasheet (External Link) |
| Vendor Page | Anti MTUS1 pAb (ATL-HPA067903) |