Anti MTSS1L pAb (ATL-HPA066469 w/enhanced validation)

Atlas Antibodies

SKU:
ATL-HPA066469-25
  • Immunofluorescent staining of human cell line MCF7 shows localization to focal adhesion sites.
  • Western blot analysis in human cell line A-549 and human cell line SK-MEL-30.
Shipping:
Calculated at Checkout
$395.00
Adding to cart… The item has been added
Protein Description: metastasis suppressor 1-like
Gene Name: MTSS1L
Alternative Gene Name: ABBA-1, LOC92154
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000033763: 82%, ENSRNOG00000017500: 84%
Entrez Gene ID: 92154
Uniprot ID: Q765P7
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen TPTVPDSPGYMGPTRAGSEECVFYTDETASPLAPDLAKASPKRLSLPNTAWGSPSPEAAGYPGAGAEDEQQQLA
Gene Sequence TPTVPDSPGYMGPTRAGSEECVFYTDETASPLAPDLAKASPKRLSLPNTAWGSPSPEAAGYPGAGAEDEQQQLA
Gene ID - Mouse ENSMUSG00000033763
Gene ID - Rat ENSRNOG00000017500
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.



Documents & Links for Anti MTSS1L pAb (ATL-HPA066469 w/enhanced validation)
Datasheet Anti MTSS1L pAb (ATL-HPA066469 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti MTSS1L pAb (ATL-HPA066469 w/enhanced validation)