Anti MTSS1 pAb (ATL-HPA064003)

Atlas Antibodies

Catalog No.:
ATL-HPA064003-100
Shipping:
Calculated at Checkout
$596.00
Adding to cart… The item has been added
Protein Description: MTSS1, I-BAR domain containing
Gene Name: MTSS1
Alternative Gene Name: KIAA0429, MIM, MIMA, MIMB
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000022353: 90%, ENSRNOG00000009001: 82%
Entrez Gene ID: 9788
Uniprot ID: O43312
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen GVTSMPSSMWSGQASVNPPLPGPKPSIPEEHRQAIPESEAEDQEREPPSATVSPGQIPESDPADLSP
Gene Sequence GVTSMPSSMWSGQASVNPPLPGPKPSIPEEHRQAIPESEAEDQEREPPSATVSPGQIPESDPADLSP
Gene ID - Mouse ENSMUSG00000022353
Gene ID - Rat ENSRNOG00000009001
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti MTSS1 pAb (ATL-HPA064003)
Datasheet Anti MTSS1 pAb (ATL-HPA064003) Datasheet (External Link)
Vendor Page Anti MTSS1 pAb (ATL-HPA064003) at Atlas Antibodies

Documents & Links for Anti MTSS1 pAb (ATL-HPA064003)
Datasheet Anti MTSS1 pAb (ATL-HPA064003) Datasheet (External Link)
Vendor Page Anti MTSS1 pAb (ATL-HPA064003)