Anti MTSS1 pAb (ATL-HPA064003)

Atlas Antibodies

SKU: ATL-HPA064003-100

• 

Protein Description: MTSS1, I-BAR domain containing
Gene Name: MTSS1
Alternative Gene Name: KIAA0429, MIM, MIMA, MIMB
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000022353: 90%, ENSRNOG00000009001: 82%
Entrez Gene ID: 9788
Uniprot ID: O43312
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: GVTSMPSSMWSGQASVNPPLPGPKPSIPEEHRQAIPESEAEDQEREPPSATVSPGQIPESDPADLSP
• Gene Sequence: GVTSMPSSMWSGQASVNPPLPGPKPSIPEEHRQAIPESEAEDQEREPPSATVSPGQIPESDPADLSP
• Gene ID - Mouse: ENSMUSG00000022353
• Gene ID - Rat: ENSRNOG00000009001
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.