Anti MTOR pAb (ATL-HPA071227)
Atlas Antibodies
- Catalog No.:
- ATL-HPA071227-25
- Shipping:
- Calculated at Checkout
$328.00
Gene Name: MTOR
Alternative Gene Name: FLJ44809, FRAP, FRAP1, FRAP2, RAFT1, RAPT1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000028991: 99%, ENSRNOG00000009615: 99%
Entrez Gene ID: 2475
Uniprot ID: P42345
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | ICC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | TESLDSTDYASRIIHPIVRTLDQSPELRSTAMDTLSSLVFQLGKKYQIFIPMVNKVLVRHRINHQRYDVLICRIVKGYTLADE |
Gene Sequence | TESLDSTDYASRIIHPIVRTLDQSPELRSTAMDTLSSLVFQLGKKYQIFIPMVNKVLVRHRINHQRYDVLICRIVKGYTLADE |
Gene ID - Mouse | ENSMUSG00000028991 |
Gene ID - Rat | ENSRNOG00000009615 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti MTOR pAb (ATL-HPA071227) | |
Datasheet | Anti MTOR pAb (ATL-HPA071227) Datasheet (External Link) |
Vendor Page | Anti MTOR pAb (ATL-HPA071227) at Atlas Antibodies |
Documents & Links for Anti MTOR pAb (ATL-HPA071227) | |
Datasheet | Anti MTOR pAb (ATL-HPA071227) Datasheet (External Link) |
Vendor Page | Anti MTOR pAb (ATL-HPA071227) |