Anti MTOR pAb (ATL-HPA071227)

Atlas Antibodies

Catalog No.:
ATL-HPA071227-25
Shipping:
Calculated at Checkout
$328.00
Adding to cart… The item has been added
Protein Description: mechanistic target of rapamycin (serine/threonine kinase)
Gene Name: MTOR
Alternative Gene Name: FLJ44809, FRAP, FRAP1, FRAP2, RAFT1, RAPT1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000028991: 99%, ENSRNOG00000009615: 99%
Entrez Gene ID: 2475
Uniprot ID: P42345
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen TESLDSTDYASRIIHPIVRTLDQSPELRSTAMDTLSSLVFQLGKKYQIFIPMVNKVLVRHRINHQRYDVLICRIVKGYTLADE
Gene Sequence TESLDSTDYASRIIHPIVRTLDQSPELRSTAMDTLSSLVFQLGKKYQIFIPMVNKVLVRHRINHQRYDVLICRIVKGYTLADE
Gene ID - Mouse ENSMUSG00000028991
Gene ID - Rat ENSRNOG00000009615
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti MTOR pAb (ATL-HPA071227)
Datasheet Anti MTOR pAb (ATL-HPA071227) Datasheet (External Link)
Vendor Page Anti MTOR pAb (ATL-HPA071227) at Atlas Antibodies

Documents & Links for Anti MTOR pAb (ATL-HPA071227)
Datasheet Anti MTOR pAb (ATL-HPA071227) Datasheet (External Link)
Vendor Page Anti MTOR pAb (ATL-HPA071227)