Anti MTO1 pAb (ATL-HPA030230)

Atlas Antibodies

Catalog No.: ATL-HPA030230-25

Protein Description: mitochondrial tRNA translation optimization 1
Gene Name: MTO1
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000032342: 79%, ENSRNOG00000037659: 79%
Entrez Gene ID: 25821
Uniprot ID: Q9Y2Z2
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: RPDNADSRLTLRGYKDAGCVSQQRYERACWMKSSLEEGISVLKSIEFLSSKWKKLIPEASISTSRSLPVRALDVLKYE
• Gene Sequence: RPDNADSRLTLRGYKDAGCVSQQRYERACWMKSSLEEGISVLKSIEFLSSKWKKLIPEASISTSRSLPVRALDVLKYE
• Gene ID - Mouse: ENSMUSG00000032342
• Gene ID - Rat: ENSRNOG00000037659
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.