Anti MTHFS pAb (ATL-HPA054177)

Atlas Antibodies

Catalog No.:
ATL-HPA054177-100
Shipping:
Calculated at Checkout
$596.00
Adding to cart… The item has been added
Protein Description: 5,10-methenyltetrahydrofolate synthetase (5-formyltetrahydrofolate cyclo-ligase)
Gene Name: MTHFS
Alternative Gene Name: HsT19268
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000066442: 79%, ENSRNOG00000013229: 79%
Entrez Gene ID: 10588
Uniprot ID: P49914
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen AAAAVSSAKRSLRGELKQRLRAMSAEERLRQSRVLSQKVIAHSEYQKSKRISIFLSMQDEIETEEIIKDIFQRGKICFIPRYRFQSNHMDMVRIESPEEIS
Gene Sequence AAAAVSSAKRSLRGELKQRLRAMSAEERLRQSRVLSQKVIAHSEYQKSKRISIFLSMQDEIETEEIIKDIFQRGKICFIPRYRFQSNHMDMVRIESPEEIS
Gene ID - Mouse ENSMUSG00000066442
Gene ID - Rat ENSRNOG00000013229
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti MTHFS pAb (ATL-HPA054177)
Datasheet Anti MTHFS pAb (ATL-HPA054177) Datasheet (External Link)
Vendor Page Anti MTHFS pAb (ATL-HPA054177) at Atlas Antibodies

Documents & Links for Anti MTHFS pAb (ATL-HPA054177)
Datasheet Anti MTHFS pAb (ATL-HPA054177) Datasheet (External Link)
Vendor Page Anti MTHFS pAb (ATL-HPA054177)