Anti MTHFR pAb (ATL-HPA076180 w/enhanced validation)

Atlas Antibodies

Catalog No.:
ATL-HPA076180-25
Shipping:
Calculated at Checkout
$351.00
Adding to cart… The item has been added
Protein Description: methylenetetrahydrofolate reductase
Gene Name: MTHFR
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000029009: 88%, ENSRNOG00000008553: 89%
Entrez Gene ID: 4524
Uniprot ID: P42898
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen EELTSEESVFEVFVLYLSGEPNRNGHKVTCLPWNDEPLAAETSLLKEELLRVNRQGILTINSQPNINGKPSSDPI
Gene Sequence EELTSEESVFEVFVLYLSGEPNRNGHKVTCLPWNDEPLAAETSLLKEELLRVNRQGILTINSQPNINGKPSSDPI
Gene ID - Mouse ENSMUSG00000029009
Gene ID - Rat ENSRNOG00000008553
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti MTHFR pAb (ATL-HPA076180 w/enhanced validation)
Datasheet Anti MTHFR pAb (ATL-HPA076180 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti MTHFR pAb (ATL-HPA076180 w/enhanced validation) at Atlas Antibodies

Documents & Links for Anti MTHFR pAb (ATL-HPA076180 w/enhanced validation)
Datasheet Anti MTHFR pAb (ATL-HPA076180 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti MTHFR pAb (ATL-HPA076180 w/enhanced validation)