Anti MTHFD2 pAb (ATL-HPA049657)
Atlas Antibodies
- Catalog No.:
- ATL-HPA049657-25
- Shipping:
- Calculated at Checkout
$303.00
Gene Name: MTHFD2
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000005667: 88%, ENSRNOG00000010833: 85%
Entrez Gene ID: 10797
Uniprot ID: P13995
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | PASHSYVLNKTRAAAVVGINSETIMKPASISEEELLNLINKLNNDDNVDGLL |
Gene Sequence | PASHSYVLNKTRAAAVVGINSETIMKPASISEEELLNLINKLNNDDNVDGLL |
Gene ID - Mouse | ENSMUSG00000005667 |
Gene ID - Rat | ENSRNOG00000010833 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti MTHFD2 pAb (ATL-HPA049657) | |
Datasheet | Anti MTHFD2 pAb (ATL-HPA049657) Datasheet (External Link) |
Vendor Page | Anti MTHFD2 pAb (ATL-HPA049657) at Atlas Antibodies |
Documents & Links for Anti MTHFD2 pAb (ATL-HPA049657) | |
Datasheet | Anti MTHFD2 pAb (ATL-HPA049657) Datasheet (External Link) |
Vendor Page | Anti MTHFD2 pAb (ATL-HPA049657) |
Citations for Anti MTHFD2 pAb (ATL-HPA049657) – 1 Found |
Yu, Chang; Yang, Lehe; Cai, Mengsi; Zhou, Feng; Xiao, Sisi; Li, Yaozhe; Wan, Tingting; Cheng, Dezhi; Wang, Liangxing; Zhao, Chengguang; Huang, Xiaoying. Down-regulation of MTHFD2 inhibits NSCLC progression by suppressing cycle-related genes. Journal Of Cellular And Molecular Medicine. 2020;24(2):1568-1577. PubMed |