Anti MTHFD2 pAb (ATL-HPA049657)

Atlas Antibodies

Catalog No.:
ATL-HPA049657-25
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: methylenetetrahydrofolate dehydrogenase (NADP+ dependent) 2, methenyltetrahydrofolate cyclohydrolase
Gene Name: MTHFD2
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000005667: 88%, ENSRNOG00000010833: 85%
Entrez Gene ID: 10797
Uniprot ID: P13995
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen PASHSYVLNKTRAAAVVGINSETIMKPASISEEELLNLINKLNNDDNVDGLL
Gene Sequence PASHSYVLNKTRAAAVVGINSETIMKPASISEEELLNLINKLNNDDNVDGLL
Gene ID - Mouse ENSMUSG00000005667
Gene ID - Rat ENSRNOG00000010833
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti MTHFD2 pAb (ATL-HPA049657)
Datasheet Anti MTHFD2 pAb (ATL-HPA049657) Datasheet (External Link)
Vendor Page Anti MTHFD2 pAb (ATL-HPA049657) at Atlas Antibodies

Documents & Links for Anti MTHFD2 pAb (ATL-HPA049657)
Datasheet Anti MTHFD2 pAb (ATL-HPA049657) Datasheet (External Link)
Vendor Page Anti MTHFD2 pAb (ATL-HPA049657)
Citations for Anti MTHFD2 pAb (ATL-HPA049657) – 1 Found
Yu, Chang; Yang, Lehe; Cai, Mengsi; Zhou, Feng; Xiao, Sisi; Li, Yaozhe; Wan, Tingting; Cheng, Dezhi; Wang, Liangxing; Zhao, Chengguang; Huang, Xiaoying. Down-regulation of MTHFD2 inhibits NSCLC progression by suppressing cycle-related genes. Journal Of Cellular And Molecular Medicine. 2020;24(2):1568-1577.  PubMed