Anti MTHFD1L pAb (ATL-HPA029040 w/enhanced validation)
Atlas Antibodies
- Catalog No.:
- ATL-HPA029040-25
- Shipping:
- Calculated at Checkout
$324.00
Gene Name: MTHFD1L
Alternative Gene Name: DKFZP586G1517, FLJ21145, FTHFSDC1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000040675: 83%, ENSRNOG00000019582: 84%
Entrez Gene ID: 25902
Uniprot ID: Q6UB35
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | WB, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | ARDSIVREVIQNSKEVLSLLQEKNPAFKPVLAIIQAGDDNLMQEINQNLAEEAGLNITHICLPPDSSEAEIIDEILKINEDTRVHGLALQ |
| Gene Sequence | ARDSIVREVIQNSKEVLSLLQEKNPAFKPVLAIIQAGDDNLMQEINQNLAEEAGLNITHICLPPDSSEAEIIDEILKINEDTRVHGLALQ |
| Gene ID - Mouse | ENSMUSG00000040675 |
| Gene ID - Rat | ENSRNOG00000019582 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti MTHFD1L pAb (ATL-HPA029040 w/enhanced validation) | |
| Datasheet | Anti MTHFD1L pAb (ATL-HPA029040 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti MTHFD1L pAb (ATL-HPA029040 w/enhanced validation) at Atlas Antibodies |
| Documents & Links for Anti MTHFD1L pAb (ATL-HPA029040 w/enhanced validation) | |
| Datasheet | Anti MTHFD1L pAb (ATL-HPA029040 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti MTHFD1L pAb (ATL-HPA029040 w/enhanced validation) |
| Citations for Anti MTHFD1L pAb (ATL-HPA029040 w/enhanced validation) – 2 Found |
| Byström, Sanna; Fredolini, Claudia; Edqvist, Per-Henrik; Nyaiesh, Etienne-Nicholas; Drobin, Kimi; Uhlén, Mathias; Bergqvist, Michael; Pontén, Fredrik; Schwenk, Jochen M. Affinity Proteomics Exploration of Melanoma Identifies Proteins in Serum with Associations to T-Stage and Recurrence. Translational Oncology. 2017;10(3):385-395. PubMed |
| Zhao, Liang; Cheng, Zhe; Lu, Zhiyue; Jin, Jianqiu. NAD-dependent methylenetetrahydrofolate dehydrogenase inhibits oral squamous cell carcinoma cell proliferation and promotes apoptosis. Translational Cancer Research. 2021;10(3):1457-1469. PubMed |