Anti MTHFD1L pAb (ATL-HPA029040 w/enhanced validation)

Atlas Antibodies

Catalog No.:
ATL-HPA029040-25
Shipping:
Calculated at Checkout
$324.00
Adding to cart… The item has been added
Protein Description: methylenetetrahydrofolate dehydrogenase (NADP+ dependent) 1-like
Gene Name: MTHFD1L
Alternative Gene Name: DKFZP586G1517, FLJ21145, FTHFSDC1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000040675: 83%, ENSRNOG00000019582: 84%
Entrez Gene ID: 25902
Uniprot ID: Q6UB35
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen ARDSIVREVIQNSKEVLSLLQEKNPAFKPVLAIIQAGDDNLMQEINQNLAEEAGLNITHICLPPDSSEAEIIDEILKINEDTRVHGLALQ
Gene Sequence ARDSIVREVIQNSKEVLSLLQEKNPAFKPVLAIIQAGDDNLMQEINQNLAEEAGLNITHICLPPDSSEAEIIDEILKINEDTRVHGLALQ
Gene ID - Mouse ENSMUSG00000040675
Gene ID - Rat ENSRNOG00000019582
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti MTHFD1L pAb (ATL-HPA029040 w/enhanced validation)
Datasheet Anti MTHFD1L pAb (ATL-HPA029040 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti MTHFD1L pAb (ATL-HPA029040 w/enhanced validation) at Atlas Antibodies

Documents & Links for Anti MTHFD1L pAb (ATL-HPA029040 w/enhanced validation)
Datasheet Anti MTHFD1L pAb (ATL-HPA029040 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti MTHFD1L pAb (ATL-HPA029040 w/enhanced validation)
Citations for Anti MTHFD1L pAb (ATL-HPA029040 w/enhanced validation) – 2 Found
Byström, Sanna; Fredolini, Claudia; Edqvist, Per-Henrik; Nyaiesh, Etienne-Nicholas; Drobin, Kimi; Uhlén, Mathias; Bergqvist, Michael; Pontén, Fredrik; Schwenk, Jochen M. Affinity Proteomics Exploration of Melanoma Identifies Proteins in Serum with Associations to T-Stage and Recurrence. Translational Oncology. 2017;10(3):385-395.  PubMed
Zhao, Liang; Cheng, Zhe; Lu, Zhiyue; Jin, Jianqiu. NAD-dependent methylenetetrahydrofolate dehydrogenase inhibits oral squamous cell carcinoma cell proliferation and promotes apoptosis. Translational Cancer Research. 2021;10(3):1457-1469.  PubMed