Anti MTFR2 pAb (ATL-HPA029794)

Atlas Antibodies

Catalog No.: ATL-HPA029794-25

Protein Description: mitochondrial fission regulator 2
Gene Name: MTFR2
Alternative Gene Name: DUFD1, FAM54A
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000019992: 71%, ENSRNOG00000058050: 67%
Entrez Gene ID: 113115
Uniprot ID: Q6P444
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: LILNILREMLEYFGVPVEQVLLIWENKDYGSTRSIVRIIGKMLPLEPCRRPNFELIPLLNSVDSDNCGSMVPSFADILYVANDEEASYL
• Gene Sequence: LILNILREMLEYFGVPVEQVLLIWENKDYGSTRSIVRIIGKMLPLEPCRRPNFELIPLLNSVDSDNCGSMVPSFADILYVANDEEASYL
• Gene ID - Mouse: ENSMUSG00000019992
• Gene ID - Rat: ENSRNOG00000058050
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.