Anti MTFR2 pAb (ATL-HPA029792)

Atlas Antibodies

Catalog No.: ATL-HPA029792-25

Protein Description: mitochondrial fission regulator 2
Gene Name: MTFR2
Alternative Gene Name: DUFD1, FAM54A
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000019992: 67%, ENSRNOG00000058050: 59%
Entrez Gene ID: 113115
Uniprot ID: Q6P444
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: PLSPAVRQKETVKNDLPVNEAAIRKIAALENELTFLRSQIAAIVEMQELKNSTNSSSFGLSDE
• Gene Sequence: PLSPAVRQKETVKNDLPVNEAAIRKIAALENELTFLRSQIAAIVEMQELKNSTNSSSFGLSDE
• Gene ID - Mouse: ENSMUSG00000019992
• Gene ID - Rat: ENSRNOG00000058050
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti MTFR2 pAb (ATL-HPA029792) – 2 Found

Wang, Linbang; Liu, Wei; Liu, Jingkun; Wang, Yuanyuan; Tai, Jiaojiao; Yin, Xuedong; Tan, Jinxiang. Identification of Immune-Related Therapeutically Relevant Biomarkers in Breast Cancer and Breast Cancer Stem Cells by Transcriptome-Wide Analysis: A Clinical Prospective Study. Frontiers In Oncology. 10( 33718103):554138. 

Lian, Zengzhi; Pang, Pei; Zhu, Yan; Du, Wenwen; Zhou, Jintao. Prognostic Value and Potential Mechanism of MTFR2 in Lung Adenocarcinoma. Frontiers In Oncology. 12( 35600359):832517.