Anti MTFR1 pAb (ATL-HPA056120)

Atlas Antibodies

Catalog No.:
ATL-HPA056120-25
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: mitochondrial fission regulator 1
Gene Name: MTFR1
Alternative Gene Name: CHPPR, FAM54A2, KIAA0009
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000027601: 80%, ENSRNOG00000021359: 75%
Entrez Gene ID: 9650
Uniprot ID: Q15390
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen GLHQSTSAVDLIKERREKRANAGKTLVKNNPKKPEMPNMLEILKEMNSVKLRSVKRSEQDV
Gene Sequence GLHQSTSAVDLIKERREKRANAGKTLVKNNPKKPEMPNMLEILKEMNSVKLRSVKRSEQDV
Gene ID - Mouse ENSMUSG00000027601
Gene ID - Rat ENSRNOG00000021359
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti MTFR1 pAb (ATL-HPA056120)
Datasheet Anti MTFR1 pAb (ATL-HPA056120) Datasheet (External Link)
Vendor Page Anti MTFR1 pAb (ATL-HPA056120) at Atlas Antibodies

Documents & Links for Anti MTFR1 pAb (ATL-HPA056120)
Datasheet Anti MTFR1 pAb (ATL-HPA056120) Datasheet (External Link)
Vendor Page Anti MTFR1 pAb (ATL-HPA056120)