Anti MTFP1 pAb (ATL-HPA077396)

Atlas Antibodies

Catalog No.: ATL-HPA077396-25

Protein Description: mitochondrial fission process 1
Gene Name: MTFP1
Alternative Gene Name: HSPC242, MTP18
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000001870: 35%, ENSRNOG00000054624: 35%
Entrez Gene ID: 51537
Uniprot ID: Q9UDX5
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: CFMSTSYSCQGMWTPGSLVSKDPGTWVGLSWTEA
• Gene Sequence: CFMSTSYSCQGMWTPGSLVSKDPGTWVGLSWTEA
• Gene ID - Mouse: ENSMUSG00000001870
• Gene ID - Rat: ENSRNOG00000054624
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.