Anti MTF2 pAb (ATL-HPA069066)

Atlas Antibodies

Catalog No.: ATL-HPA069066-25

Protein Description: metal response element binding transcription factor 2
Gene Name: MTF2
Alternative Gene Name: M96, PCL2, TDRD19A
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000029267: 100%, ENSRNOG00000000075: 99%
Entrez Gene ID: 22823
Uniprot ID: Q9Y483
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: AHLCLYNLSVIHKKKYFDSELELMTYINENWDRLHPGELADTPKSERYEHVLEALNDYKTMFMSGKEI
• Gene Sequence: AHLCLYNLSVIHKKKYFDSELELMTYINENWDRLHPGELADTPKSERYEHVLEALNDYKTMFMSGKEI
• Gene ID - Mouse: ENSMUSG00000029267
• Gene ID - Rat: ENSRNOG00000000075
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.