Anti MTF2 pAb (ATL-HPA069066)
Atlas Antibodies
- Catalog No.:
- ATL-HPA069066-25
- Shipping:
- Calculated at Checkout
$447.00
Gene Name: MTF2
Alternative Gene Name: M96, PCL2, TDRD19A
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000029267: 100%, ENSRNOG00000000075: 99%
Entrez Gene ID: 22823
Uniprot ID: Q9Y483
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | WB, ICC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | AHLCLYNLSVIHKKKYFDSELELMTYINENWDRLHPGELADTPKSERYEHVLEALNDYKTMFMSGKEI |
Gene Sequence | AHLCLYNLSVIHKKKYFDSELELMTYINENWDRLHPGELADTPKSERYEHVLEALNDYKTMFMSGKEI |
Gene ID - Mouse | ENSMUSG00000029267 |
Gene ID - Rat | ENSRNOG00000000075 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti MTF2 pAb (ATL-HPA069066) | |
Datasheet | Anti MTF2 pAb (ATL-HPA069066) Datasheet (External Link) |
Vendor Page | Anti MTF2 pAb (ATL-HPA069066) at Atlas Antibodies |
Documents & Links for Anti MTF2 pAb (ATL-HPA069066) | |
Datasheet | Anti MTF2 pAb (ATL-HPA069066) Datasheet (External Link) |
Vendor Page | Anti MTF2 pAb (ATL-HPA069066) |