Anti MTF2 pAb (ATL-HPA069066)
Atlas Antibodies
- Catalog No.:
- ATL-HPA069066-25
- Shipping:
- Calculated at Checkout
$478.00
Gene Name: MTF2
Alternative Gene Name: M96, PCL2, TDRD19A
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000029267: 100%, ENSRNOG00000000075: 99%
Entrez Gene ID: 22823
Uniprot ID: Q9Y483
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | WB, ICC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | AHLCLYNLSVIHKKKYFDSELELMTYINENWDRLHPGELADTPKSERYEHVLEALNDYKTMFMSGKEI |
| Gene Sequence | AHLCLYNLSVIHKKKYFDSELELMTYINENWDRLHPGELADTPKSERYEHVLEALNDYKTMFMSGKEI |
| Gene ID - Mouse | ENSMUSG00000029267 |
| Gene ID - Rat | ENSRNOG00000000075 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti MTF2 pAb (ATL-HPA069066) | |
| Datasheet | Anti MTF2 pAb (ATL-HPA069066) Datasheet (External Link) |
| Vendor Page | Anti MTF2 pAb (ATL-HPA069066) at Atlas Antibodies |
| Documents & Links for Anti MTF2 pAb (ATL-HPA069066) | |
| Datasheet | Anti MTF2 pAb (ATL-HPA069066) Datasheet (External Link) |
| Vendor Page | Anti MTF2 pAb (ATL-HPA069066) |