Anti MTBP pAb (ATL-HPA025694)

Atlas Antibodies

Catalog No.:
ATL-HPA025694-25
Shipping:
Calculated at Checkout
$324.00
Adding to cart… The item has been added
Protein Description: MDM2 binding protein
Gene Name: MTBP
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000022369: 93%, ENSRNOG00000004412: 91%
Entrez Gene ID: 27085
Uniprot ID: Q96DY7
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen DAKELLKYFTSDGLPIGDLQPLPIQKGEKTFVLTPELSPGKLQVLPFEKASVCHYHGIEYCLDDRKALERDGGFSELQSRLIRYETQTTCTR
Gene Sequence DAKELLKYFTSDGLPIGDLQPLPIQKGEKTFVLTPELSPGKLQVLPFEKASVCHYHGIEYCLDDRKALERDGGFSELQSRLIRYETQTTCTR
Gene ID - Mouse ENSMUSG00000022369
Gene ID - Rat ENSRNOG00000004412
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti MTBP pAb (ATL-HPA025694)
Datasheet Anti MTBP pAb (ATL-HPA025694) Datasheet (External Link)
Vendor Page Anti MTBP pAb (ATL-HPA025694) at Atlas Antibodies

Documents & Links for Anti MTBP pAb (ATL-HPA025694)
Datasheet Anti MTBP pAb (ATL-HPA025694) Datasheet (External Link)
Vendor Page Anti MTBP pAb (ATL-HPA025694)