Anti MTA2 pAb (ATL-HPA072727)

Atlas Antibodies

Catalog No.: ATL-HPA072727-25

Protein Description: metastasis associated 1 family member 2
Gene Name: MTA2
Alternative Gene Name: MTA1-L1, MTA1L1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000071646: 98%, ENSRNOG00000019913: 98%
Entrez Gene ID: 9219
Uniprot ID: O94776
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: KTPTQLEGATRGTTEPHSRGHLSRPEAQSLSPYTTSANRAKLLAKNRQTFLLQTTK
• Gene Sequence: KTPTQLEGATRGTTEPHSRGHLSRPEAQSLSPYTTSANRAKLLAKNRQTFLLQTTK
• Gene ID - Mouse: ENSMUSG00000071646
• Gene ID - Rat: ENSRNOG00000019913
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.