Anti MTA2 pAb (ATL-HPA072727)

Atlas Antibodies

Catalog No.:
ATL-HPA072727-25
Shipping:
Calculated at Checkout
$423.00
Adding to cart… The item has been added
Protein Description: metastasis associated 1 family member 2
Gene Name: MTA2
Alternative Gene Name: MTA1-L1, MTA1L1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000071646: 98%, ENSRNOG00000019913: 98%
Entrez Gene ID: 9219
Uniprot ID: O94776
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen KTPTQLEGATRGTTEPHSRGHLSRPEAQSLSPYTTSANRAKLLAKNRQTFLLQTTK
Gene Sequence KTPTQLEGATRGTTEPHSRGHLSRPEAQSLSPYTTSANRAKLLAKNRQTFLLQTTK
Gene ID - Mouse ENSMUSG00000071646
Gene ID - Rat ENSRNOG00000019913
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti MTA2 pAb (ATL-HPA072727)
Datasheet Anti MTA2 pAb (ATL-HPA072727) Datasheet (External Link)
Vendor Page Anti MTA2 pAb (ATL-HPA072727) at Atlas Antibodies

Documents & Links for Anti MTA2 pAb (ATL-HPA072727)
Datasheet Anti MTA2 pAb (ATL-HPA072727) Datasheet (External Link)
Vendor Page Anti MTA2 pAb (ATL-HPA072727)