Anti MSTO1 pAb (ATL-HPA005899)
Atlas Antibodies
- Catalog No.:
- ATL-HPA005899-25
- Shipping:
- Calculated at Checkout
$324.00
Gene Name: MSTO1
Alternative Gene Name: FLJ10504, LST005, misato, MST
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000068922: 64%, ENSRNOG00000020357: 70%
Entrez Gene ID: 55154
Uniprot ID: Q9BUK6
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | WB, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | GLYRDKQLDAAIAWQGKLTTHKEELYPKNPYLQDFLSAEGVLSSDGVWRVKSIPNGKGSSPLPTATTPKPLIPTEASIRVWSDFLRVHLHPRSICMIQKYNHDGEAGRLEAFGQGESVLKEPKYQ |
| Gene Sequence | GLYRDKQLDAAIAWQGKLTTHKEELYPKNPYLQDFLSAEGVLSSDGVWRVKSIPNGKGSSPLPTATTPKPLIPTEASIRVWSDFLRVHLHPRSICMIQKYNHDGEAGRLEAFGQGESVLKEPKYQ |
| Gene ID - Mouse | ENSMUSG00000068922 |
| Gene ID - Rat | ENSRNOG00000020357 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti MSTO1 pAb (ATL-HPA005899) | |
| Datasheet | Anti MSTO1 pAb (ATL-HPA005899) Datasheet (External Link) |
| Vendor Page | Anti MSTO1 pAb (ATL-HPA005899) at Atlas Antibodies |
| Documents & Links for Anti MSTO1 pAb (ATL-HPA005899) | |
| Datasheet | Anti MSTO1 pAb (ATL-HPA005899) Datasheet (External Link) |
| Vendor Page | Anti MSTO1 pAb (ATL-HPA005899) |