Anti MSRB1 pAb (ATL-HPA069557)

Atlas Antibodies

SKU: ATL-HPA069557-25

• 

Protein Description: methionine sulfoxide reductase B1
Gene Name: MSRB1
Alternative Gene Name: SelR, SelX, SepR, SEPX1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000075705: 48%, ENSRNOG00000055314: 51%
Entrez Gene ID: 51734
Uniprot ID:
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: PGVYVCAKCGYELFSSRSKYAHSSPWPAFTETIHADSVAKRPEHNRSEALKVRGHRGGGGTGAARESREPVPPSSLCLPHSSRGLEASIPGLLPLPGSCH
• Gene Sequence: PGVYVCAKCGYELFSSRSKYAHSSPWPAFTETIHADSVAKRPEHNRSEALKVRGHRGGGGTGAARESREPVPPSSLCLPHSSRGLEASIPGLLPLPGSCH
• Gene ID - Mouse: ENSMUSG00000075705
• Gene ID - Rat: ENSRNOG00000055314
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.