Anti MSRB1 pAb (ATL-HPA069557)

Atlas Antibodies

Catalog No.:
ATL-HPA069557-25
Shipping:
Calculated at Checkout
$478.00
Adding to cart… The item has been added
Protein Description: methionine sulfoxide reductase B1
Gene Name: MSRB1
Alternative Gene Name: SelR, SelX, SepR, SEPX1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000075705: 48%, ENSRNOG00000055314: 51%
Entrez Gene ID: 51734
Uniprot ID:
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen PGVYVCAKCGYELFSSRSKYAHSSPWPAFTETIHADSVAKRPEHNRSEALKVRGHRGGGGTGAARESREPVPPSSLCLPHSSRGLEASIPGLLPLPGSCH
Gene Sequence PGVYVCAKCGYELFSSRSKYAHSSPWPAFTETIHADSVAKRPEHNRSEALKVRGHRGGGGTGAARESREPVPPSSLCLPHSSRGLEASIPGLLPLPGSCH
Gene ID - Mouse ENSMUSG00000075705
Gene ID - Rat ENSRNOG00000055314
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti MSRB1 pAb (ATL-HPA069557)
Datasheet Anti MSRB1 pAb (ATL-HPA069557) Datasheet (External Link)
Vendor Page Anti MSRB1 pAb (ATL-HPA069557) at Atlas Antibodies

Documents & Links for Anti MSRB1 pAb (ATL-HPA069557)
Datasheet Anti MSRB1 pAb (ATL-HPA069557) Datasheet (External Link)
Vendor Page Anti MSRB1 pAb (ATL-HPA069557)