Anti MSRA pAb (ATL-HPA053069)

Atlas Antibodies

Catalog No.:
ATL-HPA053069-25
Shipping:
Calculated at Checkout
$324.00
Adding to cart… The item has been added
Protein Description: methionine sulfoxide reductase A
Gene Name: MSRA
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000054733: 87%, ENSRNOG00000012440: 65%
Entrez Gene ID: 4482
Uniprot ID: Q9UJ68
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen AKQMEAALSSKENYQKVLSEHGFGPITTDIREGQTFYYAEDYHQQYLSKNPNGYCGLGGTGVSCPVGIK
Gene Sequence AKQMEAALSSKENYQKVLSEHGFGPITTDIREGQTFYYAEDYHQQYLSKNPNGYCGLGGTGVSCPVGIK
Gene ID - Mouse ENSMUSG00000054733
Gene ID - Rat ENSRNOG00000012440
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti MSRA pAb (ATL-HPA053069)
Datasheet Anti MSRA pAb (ATL-HPA053069) Datasheet (External Link)
Vendor Page Anti MSRA pAb (ATL-HPA053069) at Atlas Antibodies

Documents & Links for Anti MSRA pAb (ATL-HPA053069)
Datasheet Anti MSRA pAb (ATL-HPA053069) Datasheet (External Link)
Vendor Page Anti MSRA pAb (ATL-HPA053069)