Anti MSRA pAb (ATL-HPA053069)
Atlas Antibodies
- Catalog No.:
- ATL-HPA053069-25
- Shipping:
- Calculated at Checkout
$303.00
Gene Name: MSRA
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000054733: 87%, ENSRNOG00000012440: 65%
Entrez Gene ID: 4482
Uniprot ID: Q9UJ68
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | ICC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | AKQMEAALSSKENYQKVLSEHGFGPITTDIREGQTFYYAEDYHQQYLSKNPNGYCGLGGTGVSCPVGIK |
Gene Sequence | AKQMEAALSSKENYQKVLSEHGFGPITTDIREGQTFYYAEDYHQQYLSKNPNGYCGLGGTGVSCPVGIK |
Gene ID - Mouse | ENSMUSG00000054733 |
Gene ID - Rat | ENSRNOG00000012440 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti MSRA pAb (ATL-HPA053069) | |
Datasheet | Anti MSRA pAb (ATL-HPA053069) Datasheet (External Link) |
Vendor Page | Anti MSRA pAb (ATL-HPA053069) at Atlas Antibodies |
Documents & Links for Anti MSRA pAb (ATL-HPA053069) | |
Datasheet | Anti MSRA pAb (ATL-HPA053069) Datasheet (External Link) |
Vendor Page | Anti MSRA pAb (ATL-HPA053069) |