Anti MSMO1 pAb (ATL-HPA056127)

Atlas Antibodies

Catalog No.:
ATL-HPA056127-25
Shipping:
Calculated at Checkout
$478.00
Adding to cart… The item has been added
Protein Description: methylsterol monooxygenase 1
Gene Name: MSMO1
Alternative Gene Name: DESP4, ERG25, SC4MOL
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000031604: 88%, ENSRNOG00000032297: 84%
Entrez Gene ID: 6307
Uniprot ID: Q15800
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen MATNESVSIFSSASLAVEYVDSLLPENPLQEPFKNAWNYMLNN
Gene Sequence MATNESVSIFSSASLAVEYVDSLLPENPLQEPFKNAWNYMLNN
Gene ID - Mouse ENSMUSG00000031604
Gene ID - Rat ENSRNOG00000032297
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti MSMO1 pAb (ATL-HPA056127)
Datasheet Anti MSMO1 pAb (ATL-HPA056127) Datasheet (External Link)
Vendor Page Anti MSMO1 pAb (ATL-HPA056127) at Atlas Antibodies

Documents & Links for Anti MSMO1 pAb (ATL-HPA056127)
Datasheet Anti MSMO1 pAb (ATL-HPA056127) Datasheet (External Link)
Vendor Page Anti MSMO1 pAb (ATL-HPA056127)