Anti MSMO1 pAb (ATL-HPA056127)

Atlas Antibodies

Catalog No.: ATL-HPA056127-25

Protein Description: methylsterol monooxygenase 1
Gene Name: MSMO1
Alternative Gene Name: DESP4, ERG25, SC4MOL
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000031604: 88%, ENSRNOG00000032297: 84%
Entrez Gene ID: 6307
Uniprot ID: Q15800
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: MATNESVSIFSSASLAVEYVDSLLPENPLQEPFKNAWNYMLNN
• Gene Sequence: MATNESVSIFSSASLAVEYVDSLLPENPLQEPFKNAWNYMLNN
• Gene ID - Mouse: ENSMUSG00000031604
• Gene ID - Rat: ENSRNOG00000032297
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.