Anti MSL1 pAb (ATL-HPA023567)

Atlas Antibodies

Catalog No.:
ATL-HPA023567-25
Shipping:
Calculated at Checkout
$478.00
Adding to cart… The item has been added
Protein Description: male-specific lethal 1 homolog (Drosophila)
Gene Name: MSL1
Alternative Gene Name: DKFZp686P24239, hMSL1, MSL-1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000052915: 97%, ENSRNOG00000009643: 95%
Entrez Gene ID: 339287
Uniprot ID: Q68DK7
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen FGSTERKTPVKKLAPEFSKVKTKTPKHSPIKEEPCGSLSETVCKRELRSQETPEKPRSSVDTPPRLSTPQKGPSTHPKEKAFSSEIEDLPYLSTTEMY
Gene Sequence FGSTERKTPVKKLAPEFSKVKTKTPKHSPIKEEPCGSLSETVCKRELRSQETPEKPRSSVDTPPRLSTPQKGPSTHPKEKAFSSEIEDLPYLSTTEMY
Gene ID - Mouse ENSMUSG00000052915
Gene ID - Rat ENSRNOG00000009643
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti MSL1 pAb (ATL-HPA023567)
Datasheet Anti MSL1 pAb (ATL-HPA023567) Datasheet (External Link)
Vendor Page Anti MSL1 pAb (ATL-HPA023567) at Atlas Antibodies

Documents & Links for Anti MSL1 pAb (ATL-HPA023567)
Datasheet Anti MSL1 pAb (ATL-HPA023567) Datasheet (External Link)
Vendor Page Anti MSL1 pAb (ATL-HPA023567)