Anti MSL1 pAb (ATL-HPA022800)

Atlas Antibodies

Catalog No.: ATL-HPA022800-25

Protein Description: male-specific lethal 1 homolog (Drosophila)
Gene Name: MSL1
Alternative Gene Name: DKFZp686P24239, hMSL1, MSL-1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000052915: 92%, ENSRNOG00000009643: 94%
Entrez Gene ID: 339287
Uniprot ID: Q68DK7
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: QQQQLQAKEKEIEELKSERDTLLARIERMERRMQLVKKDNEKERHKLFQGYETEEREETELSEKIKLECQPELSETSQTLPPKPFSCGRSGKGHK
• Gene Sequence: QQQQLQAKEKEIEELKSERDTLLARIERMERRMQLVKKDNEKERHKLFQGYETEEREETELSEKIKLECQPELSETSQTLPPKPFSCGRSGKGHK
• Gene ID - Mouse: ENSMUSG00000052915
• Gene ID - Rat: ENSRNOG00000009643
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.