Anti MSL1 pAb (ATL-HPA022800)
Atlas Antibodies
- Catalog No.:
- ATL-HPA022800-25
- Shipping:
- Calculated at Checkout
$324.00
Gene Name: MSL1
Alternative Gene Name: DKFZp686P24239, hMSL1, MSL-1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000052915: 92%, ENSRNOG00000009643: 94%
Entrez Gene ID: 339287
Uniprot ID: Q68DK7
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | QQQQLQAKEKEIEELKSERDTLLARIERMERRMQLVKKDNEKERHKLFQGYETEEREETELSEKIKLECQPELSETSQTLPPKPFSCGRSGKGHK |
| Gene Sequence | QQQQLQAKEKEIEELKSERDTLLARIERMERRMQLVKKDNEKERHKLFQGYETEEREETELSEKIKLECQPELSETSQTLPPKPFSCGRSGKGHK |
| Gene ID - Mouse | ENSMUSG00000052915 |
| Gene ID - Rat | ENSRNOG00000009643 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti MSL1 pAb (ATL-HPA022800) | |
| Datasheet | Anti MSL1 pAb (ATL-HPA022800) Datasheet (External Link) |
| Vendor Page | Anti MSL1 pAb (ATL-HPA022800) at Atlas Antibodies |
| Documents & Links for Anti MSL1 pAb (ATL-HPA022800) | |
| Datasheet | Anti MSL1 pAb (ATL-HPA022800) Datasheet (External Link) |
| Vendor Page | Anti MSL1 pAb (ATL-HPA022800) |