Anti MSI2 pAb (ATL-HPA068990)
Atlas Antibodies
- Catalog No.:
- ATL-HPA068990-25
- Shipping:
- Calculated at Checkout
$447.00
Gene Name: MSI2
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000069769: 100%, ENSRNOG00000025338: 100%
Entrez Gene ID: 124540
Uniprot ID: Q96DH6
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | NFVATYGRGYPGFAPSYGYQFPGFPAAAYGPVAAA |
| Gene Sequence | NFVATYGRGYPGFAPSYGYQFPGFPAAAYGPVAAA |
| Gene ID - Mouse | ENSMUSG00000069769 |
| Gene ID - Rat | ENSRNOG00000025338 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti MSI2 pAb (ATL-HPA068990) | |
| Datasheet | Anti MSI2 pAb (ATL-HPA068990) Datasheet (External Link) |
| Vendor Page | Anti MSI2 pAb (ATL-HPA068990) at Atlas Antibodies |
| Documents & Links for Anti MSI2 pAb (ATL-HPA068990) | |
| Datasheet | Anti MSI2 pAb (ATL-HPA068990) Datasheet (External Link) |
| Vendor Page | Anti MSI2 pAb (ATL-HPA068990) |