Anti MSI2 pAb (ATL-HPA068990)

Atlas Antibodies

Catalog No.:
ATL-HPA068990-25
Shipping:
Calculated at Checkout
$478.00
Adding to cart… The item has been added
Protein Description: musashi RNA binding protein 2
Gene Name: MSI2
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000069769: 100%, ENSRNOG00000025338: 100%
Entrez Gene ID: 124540
Uniprot ID: Q96DH6
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen NFVATYGRGYPGFAPSYGYQFPGFPAAAYGPVAAA
Gene Sequence NFVATYGRGYPGFAPSYGYQFPGFPAAAYGPVAAA
Gene ID - Mouse ENSMUSG00000069769
Gene ID - Rat ENSRNOG00000025338
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti MSI2 pAb (ATL-HPA068990)
Datasheet Anti MSI2 pAb (ATL-HPA068990) Datasheet (External Link)
Vendor Page Anti MSI2 pAb (ATL-HPA068990) at Atlas Antibodies

Documents & Links for Anti MSI2 pAb (ATL-HPA068990)
Datasheet Anti MSI2 pAb (ATL-HPA068990) Datasheet (External Link)
Vendor Page Anti MSI2 pAb (ATL-HPA068990)