Anti MSI1 pAb (ATL-HPA064401)
Atlas Antibodies
- SKU:
- ATL-HPA064401-25
- Shipping:
- Calculated at Checkout
$395.00
Gene Name: MSI1
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000054256: 98%, ENSRNOG00000001156: 100%
Entrez Gene ID: 4440
Uniprot ID: O43347
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | ICC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | LGYPGFQATTYASRSYTGLAPGYTYQFPEFRVERTPLPSAPVLPELTAIPLTAYGPMA |
Gene Sequence | LGYPGFQATTYASRSYTGLAPGYTYQFPEFRVERTPLPSAPVLPELTAIPLTAYGPMA |
Gene ID - Mouse | ENSMUSG00000054256 |
Gene ID - Rat | ENSRNOG00000001156 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti MSI1 pAb (ATL-HPA064401) | |
Datasheet | Anti MSI1 pAb (ATL-HPA064401) Datasheet (External Link) |
Vendor Page | Anti MSI1 pAb (ATL-HPA064401) at Atlas Antibodies |
Documents & Links for Anti MSI1 pAb (ATL-HPA064401) | |
Datasheet | Anti MSI1 pAb (ATL-HPA064401) Datasheet (External Link) |
Vendor Page | Anti MSI1 pAb (ATL-HPA064401) |