Anti MSI1 pAb (ATL-HPA064401)

Atlas Antibodies

Catalog No.:
ATL-HPA064401-25
Shipping:
Calculated at Checkout
$395.00
Adding to cart… The item has been added
Protein Description: musashi RNA-binding protein 1
Gene Name: MSI1
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000054256: 98%, ENSRNOG00000001156: 100%
Entrez Gene ID: 4440
Uniprot ID: O43347
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen LGYPGFQATTYASRSYTGLAPGYTYQFPEFRVERTPLPSAPVLPELTAIPLTAYGPMA
Gene Sequence LGYPGFQATTYASRSYTGLAPGYTYQFPEFRVERTPLPSAPVLPELTAIPLTAYGPMA
Gene ID - Mouse ENSMUSG00000054256
Gene ID - Rat ENSRNOG00000001156
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti MSI1 pAb (ATL-HPA064401)
Datasheet Anti MSI1 pAb (ATL-HPA064401) Datasheet (External Link)
Vendor Page Anti MSI1 pAb (ATL-HPA064401) at Atlas Antibodies

Documents & Links for Anti MSI1 pAb (ATL-HPA064401)
Datasheet Anti MSI1 pAb (ATL-HPA064401) Datasheet (External Link)
Vendor Page Anti MSI1 pAb (ATL-HPA064401)