Anti MSH2 pAb (ATL-HPA066845)

Atlas Antibodies

Catalog No.: ATL-HPA066845-25

Protein Description: mutS homolog 2
Gene Name: MSH2
Alternative Gene Name: COCA1, HNPCC, HNPCC1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000024151: 95%, ENSRNOG00000015796: 95%
Entrez Gene ID: 4436
Uniprot ID: P43246
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: FDRGDFYTAHGEDALLAAREVFKTQGVIKYMGPAGAKNLQSVVLSKMNFESFVKDLLLVRQYRVEVYKNRAGNKASKENDWYLA
• Gene Sequence: FDRGDFYTAHGEDALLAAREVFKTQGVIKYMGPAGAKNLQSVVLSKMNFESFVKDLLLVRQYRVEVYKNRAGNKASKENDWYLA
• Gene ID - Mouse: ENSMUSG00000024151
• Gene ID - Rat: ENSRNOG00000015796
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.