Anti MSC pAb (ATL-HPA062878)

Atlas Antibodies

SKU:
ATL-HPA062878-25
  • Immunofluorescent staining of human cell line SK-MEL-30 shows localization to nucleoplasm.
  • Western blot analysis in human cell line RT-4.
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: musculin
Gene Name: MSC
Alternative Gene Name: ABF-1, bHLHa22
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000025930: 74%, ENSRNOG00000007540: 81%
Entrez Gene ID: 9242
Uniprot ID: O60682
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen TGSVSDPEEMELRGLQREYPVPASKRPPLRGVERSYASPSDNS
Gene Sequence TGSVSDPEEMELRGLQREYPVPASKRPPLRGVERSYASPSDNS
Gene ID - Mouse ENSMUSG00000025930
Gene ID - Rat ENSRNOG00000007540
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti MSC pAb (ATL-HPA062878)
Datasheet Anti MSC pAb (ATL-HPA062878) Datasheet (External Link)
Vendor Page Anti MSC pAb (ATL-HPA062878) at Atlas Antibodies

Documents & Links for Anti MSC pAb (ATL-HPA062878)
Datasheet Anti MSC pAb (ATL-HPA062878) Datasheet (External Link)
Vendor Page Anti MSC pAb (ATL-HPA062878)