Anti MSC pAb (ATL-HPA062878)
Atlas Antibodies
- Catalog No.:
- ATL-HPA062878-25
- Shipping:
- Calculated at Checkout
$324.00
Gene Name: MSC
Alternative Gene Name: ABF-1, bHLHa22
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000025930: 74%, ENSRNOG00000007540: 81%
Entrez Gene ID: 9242
Uniprot ID: O60682
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | WB, ICC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | TGSVSDPEEMELRGLQREYPVPASKRPPLRGVERSYASPSDNS |
| Gene Sequence | TGSVSDPEEMELRGLQREYPVPASKRPPLRGVERSYASPSDNS |
| Gene ID - Mouse | ENSMUSG00000025930 |
| Gene ID - Rat | ENSRNOG00000007540 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti MSC pAb (ATL-HPA062878) | |
| Datasheet | Anti MSC pAb (ATL-HPA062878) Datasheet (External Link) |
| Vendor Page | Anti MSC pAb (ATL-HPA062878) at Atlas Antibodies |
| Documents & Links for Anti MSC pAb (ATL-HPA062878) | |
| Datasheet | Anti MSC pAb (ATL-HPA062878) Datasheet (External Link) |
| Vendor Page | Anti MSC pAb (ATL-HPA062878) |