Anti MSANTD4 pAb (ATL-HPA014411)

Atlas Antibodies

Catalog No.:
ATL-HPA014411-25
Shipping:
Calculated at Checkout
$478.00
Adding to cart… The item has been added
Protein Description: Myb/SANT-like DNA-binding domain containing 4 with coiled-coils
Gene Name: MSANTD4
Alternative Gene Name: KIAA1826
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000041124: 96%, ENSRNOG00000022245: 97%
Entrez Gene ID: 84437
Uniprot ID: Q8NCY6
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC, IHC, ChIP
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen QLNTTINVMKRMAWEEIAQCVNAVGEGEQRTGTEVKRRYLDWRALMKRKRMKANIKLVGSGFPLPSSDLDDSLTEEIDEKIGFRNDANFDWQNVADFRDAGGSLTEVKVEEEERDPQSPEFEIEEEEEMLSSV
Gene Sequence QLNTTINVMKRMAWEEIAQCVNAVGEGEQRTGTEVKRRYLDWRALMKRKRMKANIKLVGSGFPLPSSDLDDSLTEEIDEKIGFRNDANFDWQNVADFRDAGGSLTEVKVEEEERDPQSPEFEIEEEEEMLSSV
Gene ID - Mouse ENSMUSG00000041124
Gene ID - Rat ENSRNOG00000022245
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti MSANTD4 pAb (ATL-HPA014411)
Datasheet Anti MSANTD4 pAb (ATL-HPA014411) Datasheet (External Link)
Vendor Page Anti MSANTD4 pAb (ATL-HPA014411) at Atlas Antibodies

Documents & Links for Anti MSANTD4 pAb (ATL-HPA014411)
Datasheet Anti MSANTD4 pAb (ATL-HPA014411) Datasheet (External Link)
Vendor Page Anti MSANTD4 pAb (ATL-HPA014411)