Anti MS4A8 pAb (ATL-HPA007318 w/enhanced validation)

Atlas Antibodies

Catalog No.: ATL-HPA007318-25

Protein Description: membrane-spanning 4-domains, subfamily A, member 8
Gene Name: MS4A8
Alternative Gene Name: CD20L5, MS4A4, MS4A8B
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000024730: 51%, ENSRNOG00000020939: 61%
Entrez Gene ID: 83661
Uniprot ID: Q9BY19
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: MNSMTSAVPVANSVLVVAPHNGYPVTPGIMSHVPLYPNSQPQVHLVPGNPPSLVSNVNGQPVQKALKEGK
• Gene Sequence: MNSMTSAVPVANSVLVVAPHNGYPVTPGIMSHVPLYPNSQPQVHLVPGNPPSLVSNVNGQPVQKALKEGK
• Gene ID - Mouse: ENSMUSG00000024730
• Gene ID - Rat: ENSRNOG00000020939
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.