Anti MS4A8 pAb (ATL-HPA007318 w/enhanced validation)
Atlas Antibodies
- Catalog No.:
- ATL-HPA007318-25
- Shipping:
- Calculated at Checkout
$324.00
Gene Name: MS4A8
Alternative Gene Name: CD20L5, MS4A4, MS4A8B
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000024730: 51%, ENSRNOG00000020939: 61%
Entrez Gene ID: 83661
Uniprot ID: Q9BY19
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | WB, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | MNSMTSAVPVANSVLVVAPHNGYPVTPGIMSHVPLYPNSQPQVHLVPGNPPSLVSNVNGQPVQKALKEGK |
| Gene Sequence | MNSMTSAVPVANSVLVVAPHNGYPVTPGIMSHVPLYPNSQPQVHLVPGNPPSLVSNVNGQPVQKALKEGK |
| Gene ID - Mouse | ENSMUSG00000024730 |
| Gene ID - Rat | ENSRNOG00000020939 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti MS4A8 pAb (ATL-HPA007318 w/enhanced validation) | |
| Datasheet | Anti MS4A8 pAb (ATL-HPA007318 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti MS4A8 pAb (ATL-HPA007318 w/enhanced validation) at Atlas Antibodies |
| Documents & Links for Anti MS4A8 pAb (ATL-HPA007318 w/enhanced validation) | |
| Datasheet | Anti MS4A8 pAb (ATL-HPA007318 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti MS4A8 pAb (ATL-HPA007318 w/enhanced validation) |