Anti MS4A6A pAb (ATL-HPA011391)
Atlas Antibodies
- Catalog No.:
- ATL-HPA011391-25
- Shipping:
- Calculated at Checkout
$303.00
Gene Name: MS4A6A
Alternative Gene Name: CD20L3, MS4A6
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000037913: 24%, ENSRNOG00000018686: 25%
Entrez Gene ID: 64231
Uniprot ID: Q9H2W1
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | SFSPNFTQVTSTLLNSAYPFIGPFFVSRVSEEGRMGQRGEEDTNSLDFPPASLLCLICQEQGVNGESCSPV |
Gene Sequence | SFSPNFTQVTSTLLNSAYPFIGPFFVSRVSEEGRMGQRGEEDTNSLDFPPASLLCLICQEQGVNGESCSPV |
Gene ID - Mouse | ENSMUSG00000037913 |
Gene ID - Rat | ENSRNOG00000018686 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti MS4A6A pAb (ATL-HPA011391) | |
Datasheet | Anti MS4A6A pAb (ATL-HPA011391) Datasheet (External Link) |
Vendor Page | Anti MS4A6A pAb (ATL-HPA011391) at Atlas Antibodies |
Documents & Links for Anti MS4A6A pAb (ATL-HPA011391) | |
Datasheet | Anti MS4A6A pAb (ATL-HPA011391) Datasheet (External Link) |
Vendor Page | Anti MS4A6A pAb (ATL-HPA011391) |
Citations for Anti MS4A6A pAb (ATL-HPA011391) – 1 Found |
Silva-Gomes, Rita; Mapelli, Sarah N; Boutet, Marie-Astrid; Mattiola, Irene; Sironi, Marina; Grizzi, Fabio; Colombo, Federico; Supino, Domenico; Carnevale, Silvia; Pasqualini, Fabio; Stravalaci, Matteo; Porte, Rémi; Gianatti, Andrea; Pitzalis, Constantino; Locati, Massimo; Oliveira, Maria José; Bottazzi, Barbara; Mantovani, Alberto. Differential expression and regulation of MS4A family members in myeloid cells in physiological and pathological conditions. Journal Of Leukocyte Biology. 2022;111(4):817-836. PubMed |