Anti MS4A6A pAb (ATL-HPA011391)

Atlas Antibodies

Catalog No.:
ATL-HPA011391-25
Shipping:
Calculated at Checkout
$324.00
Adding to cart… The item has been added
Protein Description: membrane-spanning 4-domains, subfamily A, member 6A
Gene Name: MS4A6A
Alternative Gene Name: CD20L3, MS4A6
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000037913: 24%, ENSRNOG00000018686: 25%
Entrez Gene ID: 64231
Uniprot ID: Q9H2W1
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen SFSPNFTQVTSTLLNSAYPFIGPFFVSRVSEEGRMGQRGEEDTNSLDFPPASLLCLICQEQGVNGESCSPV
Gene Sequence SFSPNFTQVTSTLLNSAYPFIGPFFVSRVSEEGRMGQRGEEDTNSLDFPPASLLCLICQEQGVNGESCSPV
Gene ID - Mouse ENSMUSG00000037913
Gene ID - Rat ENSRNOG00000018686
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti MS4A6A pAb (ATL-HPA011391)
Datasheet Anti MS4A6A pAb (ATL-HPA011391) Datasheet (External Link)
Vendor Page Anti MS4A6A pAb (ATL-HPA011391) at Atlas Antibodies

Documents & Links for Anti MS4A6A pAb (ATL-HPA011391)
Datasheet Anti MS4A6A pAb (ATL-HPA011391) Datasheet (External Link)
Vendor Page Anti MS4A6A pAb (ATL-HPA011391)
Citations for Anti MS4A6A pAb (ATL-HPA011391) – 1 Found
Silva-Gomes, Rita; Mapelli, Sarah N; Boutet, Marie-Astrid; Mattiola, Irene; Sironi, Marina; Grizzi, Fabio; Colombo, Federico; Supino, Domenico; Carnevale, Silvia; Pasqualini, Fabio; Stravalaci, Matteo; Porte, Rémi; Gianatti, Andrea; Pitzalis, Constantino; Locati, Massimo; Oliveira, Maria José; Bottazzi, Barbara; Mantovani, Alberto. Differential expression and regulation of MS4A family members in myeloid cells in physiological and pathological conditions. Journal Of Leukocyte Biology. 2022;111(4):817-836.  PubMed