Anti MS4A2 pAb (ATL-HPA059967 w/enhanced validation)
Atlas Antibodies
- Catalog No.:
- ATL-HPA059967-25
- Shipping:
- Calculated at Checkout
$303.00
Gene Name: MS4A2
Alternative Gene Name: APY, FCER1B, IGER, MS4A1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000024680: 66%, ENSRNOG00000020993: 53%
Entrez Gene ID: 2206
Uniprot ID: Q01362
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | EELKGNKVPEDRVYEELNIYSATYSELEDPGEMSPPID |
Gene Sequence | EELKGNKVPEDRVYEELNIYSATYSELEDPGEMSPPID |
Gene ID - Mouse | ENSMUSG00000024680 |
Gene ID - Rat | ENSRNOG00000020993 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti MS4A2 pAb (ATL-HPA059967 w/enhanced validation) | |
Datasheet | Anti MS4A2 pAb (ATL-HPA059967 w/enhanced validation) Datasheet (External Link) |
Vendor Page | Anti MS4A2 pAb (ATL-HPA059967 w/enhanced validation) at Atlas Antibodies |
Documents & Links for Anti MS4A2 pAb (ATL-HPA059967 w/enhanced validation) | |
Datasheet | Anti MS4A2 pAb (ATL-HPA059967 w/enhanced validation) Datasheet (External Link) |
Vendor Page | Anti MS4A2 pAb (ATL-HPA059967 w/enhanced validation) |