Anti MS4A15 pAb (ATL-HPA054563)
Atlas Antibodies
- Catalog No.:
- ATL-HPA054563-25
- Shipping:
- Calculated at Checkout
$447.00
Gene Name: MS4A15
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000067571: 90%, ENSRNOG00000026957: 70%
Entrez Gene ID: 219995
Uniprot ID: Q8N5U1
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | MSAAPASNGVFVVIPPNNASGLCPPPAILPTSMCQPPGIMQFEEPPLGAQTPRATQPPDLRPVETFLTGE |
| Gene Sequence | MSAAPASNGVFVVIPPNNASGLCPPPAILPTSMCQPPGIMQFEEPPLGAQTPRATQPPDLRPVETFLTGE |
| Gene ID - Mouse | ENSMUSG00000067571 |
| Gene ID - Rat | ENSRNOG00000026957 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti MS4A15 pAb (ATL-HPA054563) | |
| Datasheet | Anti MS4A15 pAb (ATL-HPA054563) Datasheet (External Link) |
| Vendor Page | Anti MS4A15 pAb (ATL-HPA054563) at Atlas Antibodies |
| Documents & Links for Anti MS4A15 pAb (ATL-HPA054563) | |
| Datasheet | Anti MS4A15 pAb (ATL-HPA054563) Datasheet (External Link) |
| Vendor Page | Anti MS4A15 pAb (ATL-HPA054563) |