Anti MS4A15 pAb (ATL-HPA054563)

Atlas Antibodies

Catalog No.:
ATL-HPA054563-25
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: membrane spanning 4-domains A15
Gene Name: MS4A15
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000067571: 90%, ENSRNOG00000026957: 70%
Entrez Gene ID: 219995
Uniprot ID: Q8N5U1
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen MSAAPASNGVFVVIPPNNASGLCPPPAILPTSMCQPPGIMQFEEPPLGAQTPRATQPPDLRPVETFLTGE
Gene Sequence MSAAPASNGVFVVIPPNNASGLCPPPAILPTSMCQPPGIMQFEEPPLGAQTPRATQPPDLRPVETFLTGE
Gene ID - Mouse ENSMUSG00000067571
Gene ID - Rat ENSRNOG00000026957
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti MS4A15 pAb (ATL-HPA054563)
Datasheet Anti MS4A15 pAb (ATL-HPA054563) Datasheet (External Link)
Vendor Page Anti MS4A15 pAb (ATL-HPA054563) at Atlas Antibodies

Documents & Links for Anti MS4A15 pAb (ATL-HPA054563)
Datasheet Anti MS4A15 pAb (ATL-HPA054563) Datasheet (External Link)
Vendor Page Anti MS4A15 pAb (ATL-HPA054563)