Anti MS4A14 pAb (ATL-HPA058973)

Atlas Antibodies

SKU: ATL-HPA058973-25

• 

Protein Description: membrane spanning 4-domains A14
Gene Name: MS4A14
Alternative Gene Name: DKFZp434H092, FLJ32856, MS4A16, NYD-SP21
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000099398: 40%, ENSRNOG00000025805: 37%
Entrez Gene ID: 84689
Uniprot ID: Q96JA4
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: DQLQFVLQEEFSSDDSTTNAQSVIFGGYAFFKLTLSRSPLVSQPGNKGREFVPDEQKQSILPSPKFSEEEIEPLPP
• Gene Sequence: DQLQFVLQEEFSSDDSTTNAQSVIFGGYAFFKLTLSRSPLVSQPGNKGREFVPDEQKQSILPSPKFSEEEIEPLPP
• Gene ID - Mouse: ENSMUSG00000099398
• Gene ID - Rat: ENSRNOG00000025805
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.