Anti MRPS7 pAb (ATL-HPA023007)

Atlas Antibodies

Catalog No.: ATL-HPA023007-25

Protein Description: mitochondrial ribosomal protein S7
Gene Name: MRPS7
Alternative Gene Name: MRP-S, RP-S7, RPMS7
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000046756: 88%, ENSRNOG00000003797: 86%
Entrez Gene ID: 51081
Uniprot ID: Q9Y2R9
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: LKGGRFYQVPVPLPDRRRRFLAMKWMITECRDKKHQRTLMPEKLSHKLLEAFHNQGPVIKRKHDLHKMAEANRALAHYRWW
• Gene Sequence: LKGGRFYQVPVPLPDRRRRFLAMKWMITECRDKKHQRTLMPEKLSHKLLEAFHNQGPVIKRKHDLHKMAEANRALAHYRWW
• Gene ID - Mouse: ENSMUSG00000046756
• Gene ID - Rat: ENSRNOG00000003797
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.