Anti MRPS7 pAb (ATL-HPA022522)
Atlas Antibodies
- Catalog No.:
- ATL-HPA022522-25
- Shipping:
- Calculated at Checkout
$324.00
Gene Name: MRPS7
Alternative Gene Name: MRP-S, RP-S7, RPMS7
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000046756: 91%, ENSRNOG00000003797: 90%
Entrez Gene ID: 51081
Uniprot ID: Q9Y2R9
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | WB, ICC, IHC |
| Reactivity | Human, Mouse, Rat |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | TSSVFEDPVISKFTNMMMIGGNKVLARSLMIQTLEAVKRKQFEKYHAASAEEQATIERNPYTIFHQALKNCEPMIGLVPI |
| Gene Sequence | TSSVFEDPVISKFTNMMMIGGNKVLARSLMIQTLEAVKRKQFEKYHAASAEEQATIERNPYTIFHQALKNCEPMIGLVPI |
| Gene ID - Mouse | ENSMUSG00000046756 |
| Gene ID - Rat | ENSRNOG00000003797 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti MRPS7 pAb (ATL-HPA022522) | |
| Datasheet | Anti MRPS7 pAb (ATL-HPA022522) Datasheet (External Link) |
| Vendor Page | Anti MRPS7 pAb (ATL-HPA022522) at Atlas Antibodies |
| Documents & Links for Anti MRPS7 pAb (ATL-HPA022522) | |
| Datasheet | Anti MRPS7 pAb (ATL-HPA022522) Datasheet (External Link) |
| Vendor Page | Anti MRPS7 pAb (ATL-HPA022522) |
| Citations for Anti MRPS7 pAb (ATL-HPA022522) – 1 Found |
| Sotgia, Federica; Whitaker-Menezes, Diana; Martinez-Outschoorn, Ubaldo E; Salem, Ahmed F; Tsirigos, Aristotelis; Lamb, Rebecca; Sneddon, Sharon; Hulit, James; Howell, Anthony; Lisanti, Michael P. Mitochondria "fuel" breast cancer metabolism: fifteen markers of mitochondrial biogenesis label epithelial cancer cells, but are excluded from adjacent stromal cells. Cell Cycle (Georgetown, Tex.). 2012;11(23):4390-401. PubMed |