Anti MRPS7 pAb (ATL-HPA022522)

Atlas Antibodies

Catalog No.:
ATL-HPA022522-25
Shipping:
Calculated at Checkout
$324.00
Adding to cart… The item has been added
Protein Description: mitochondrial ribosomal protein S7
Gene Name: MRPS7
Alternative Gene Name: MRP-S, RP-S7, RPMS7
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000046756: 91%, ENSRNOG00000003797: 90%
Entrez Gene ID: 51081
Uniprot ID: Q9Y2R9
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC, IHC
Reactivity Human, Mouse, Rat
Clonality Polyclonal
Host Rabbit
Immunogen TSSVFEDPVISKFTNMMMIGGNKVLARSLMIQTLEAVKRKQFEKYHAASAEEQATIERNPYTIFHQALKNCEPMIGLVPI
Gene Sequence TSSVFEDPVISKFTNMMMIGGNKVLARSLMIQTLEAVKRKQFEKYHAASAEEQATIERNPYTIFHQALKNCEPMIGLVPI
Gene ID - Mouse ENSMUSG00000046756
Gene ID - Rat ENSRNOG00000003797
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti MRPS7 pAb (ATL-HPA022522)
Datasheet Anti MRPS7 pAb (ATL-HPA022522) Datasheet (External Link)
Vendor Page Anti MRPS7 pAb (ATL-HPA022522) at Atlas Antibodies

Documents & Links for Anti MRPS7 pAb (ATL-HPA022522)
Datasheet Anti MRPS7 pAb (ATL-HPA022522) Datasheet (External Link)
Vendor Page Anti MRPS7 pAb (ATL-HPA022522)
Citations for Anti MRPS7 pAb (ATL-HPA022522) – 1 Found
Sotgia, Federica; Whitaker-Menezes, Diana; Martinez-Outschoorn, Ubaldo E; Salem, Ahmed F; Tsirigos, Aristotelis; Lamb, Rebecca; Sneddon, Sharon; Hulit, James; Howell, Anthony; Lisanti, Michael P. Mitochondria "fuel" breast cancer metabolism: fifteen markers of mitochondrial biogenesis label epithelial cancer cells, but are excluded from adjacent stromal cells. Cell Cycle (Georgetown, Tex.). 2012;11(23):4390-401.  PubMed