Anti MRPS5 pAb (ATL-HPA055765)

Atlas Antibodies

Catalog No.:
ATL-HPA055765-25
Shipping:
Calculated at Checkout
$478.00
Adding to cart… The item has been added
Protein Description: mitochondrial ribosomal protein S5
Gene Name: MRPS5
Alternative Gene Name: MRP-S5, S5mt
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000027374: 82%, ENSRNOG00000015192: 83%
Entrez Gene ID: 64969
Uniprot ID: P82675
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen QETHQQLADKKGLHVVEIREECGPLPIVVASPRGPLRKDPEPEDEVPDVKLDWEDVKTAQGMKRSVWSNLK
Gene Sequence QETHQQLADKKGLHVVEIREECGPLPIVVASPRGPLRKDPEPEDEVPDVKLDWEDVKTAQGMKRSVWSNLK
Gene ID - Mouse ENSMUSG00000027374
Gene ID - Rat ENSRNOG00000015192
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti MRPS5 pAb (ATL-HPA055765)
Datasheet Anti MRPS5 pAb (ATL-HPA055765) Datasheet (External Link)
Vendor Page Anti MRPS5 pAb (ATL-HPA055765) at Atlas Antibodies

Documents & Links for Anti MRPS5 pAb (ATL-HPA055765)
Datasheet Anti MRPS5 pAb (ATL-HPA055765) Datasheet (External Link)
Vendor Page Anti MRPS5 pAb (ATL-HPA055765)