Anti MRPS36 pAb (ATL-HPA056795)
Atlas Antibodies
- Catalog No.:
- ATL-HPA056795-25
- Shipping:
- Calculated at Checkout
$478.00
Gene Name: MRPS36
Alternative Gene Name: DC47, MRP-S36
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000061474: 78%, ENSRNOG00000061213: 78%
Entrez Gene ID: 92259
Uniprot ID: P82909
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | MMGSKMASASRVVQVVKPHTPLIRFPDRRDNPKPNVSEALRSAGLPSHS |
| Gene Sequence | MMGSKMASASRVVQVVKPHTPLIRFPDRRDNPKPNVSEALRSAGLPSHS |
| Gene ID - Mouse | ENSMUSG00000061474 |
| Gene ID - Rat | ENSRNOG00000061213 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti MRPS36 pAb (ATL-HPA056795) | |
| Datasheet | Anti MRPS36 pAb (ATL-HPA056795) Datasheet (External Link) |
| Vendor Page | Anti MRPS36 pAb (ATL-HPA056795) at Atlas Antibodies |
| Documents & Links for Anti MRPS36 pAb (ATL-HPA056795) | |
| Datasheet | Anti MRPS36 pAb (ATL-HPA056795) Datasheet (External Link) |
| Vendor Page | Anti MRPS36 pAb (ATL-HPA056795) |