Anti MRPS36 pAb (ATL-HPA056795)

Atlas Antibodies

Catalog No.:
ATL-HPA056795-25
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: mitochondrial ribosomal protein S36
Gene Name: MRPS36
Alternative Gene Name: DC47, MRP-S36
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000061474: 78%, ENSRNOG00000061213: 78%
Entrez Gene ID: 92259
Uniprot ID: P82909
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen MMGSKMASASRVVQVVKPHTPLIRFPDRRDNPKPNVSEALRSAGLPSHS
Gene Sequence MMGSKMASASRVVQVVKPHTPLIRFPDRRDNPKPNVSEALRSAGLPSHS
Gene ID - Mouse ENSMUSG00000061474
Gene ID - Rat ENSRNOG00000061213
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti MRPS36 pAb (ATL-HPA056795)
Datasheet Anti MRPS36 pAb (ATL-HPA056795) Datasheet (External Link)
Vendor Page Anti MRPS36 pAb (ATL-HPA056795) at Atlas Antibodies

Documents & Links for Anti MRPS36 pAb (ATL-HPA056795)
Datasheet Anti MRPS36 pAb (ATL-HPA056795) Datasheet (External Link)
Vendor Page Anti MRPS36 pAb (ATL-HPA056795)