Anti MRPS36 pAb (ATL-HPA035802)

Atlas Antibodies

Catalog No.:
ATL-HPA035802-25
Shipping:
Calculated at Checkout
$478.00
Adding to cart… The item has been added
Protein Description: mitochondrial ribosomal protein S36
Gene Name: MRPS36
Alternative Gene Name: DC47, MRP-S36
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000061474: 89%, ENSRNOG00000061213: 85%
Entrez Gene ID: 92259
Uniprot ID: P82909
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen SSVISQHSKGSKSPDLLMYQGPPDTAEIIKTLPQKYRRKLVSQEEMEFIQRGGPE
Gene Sequence SSVISQHSKGSKSPDLLMYQGPPDTAEIIKTLPQKYRRKLVSQEEMEFIQRGGPE
Gene ID - Mouse ENSMUSG00000061474
Gene ID - Rat ENSRNOG00000061213
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti MRPS36 pAb (ATL-HPA035802)
Datasheet Anti MRPS36 pAb (ATL-HPA035802) Datasheet (External Link)
Vendor Page Anti MRPS36 pAb (ATL-HPA035802) at Atlas Antibodies

Documents & Links for Anti MRPS36 pAb (ATL-HPA035802)
Datasheet Anti MRPS36 pAb (ATL-HPA035802) Datasheet (External Link)
Vendor Page Anti MRPS36 pAb (ATL-HPA035802)