Anti MRPS30 pAb (ATL-HPA021149)
Atlas Antibodies
- Catalog No.:
- ATL-HPA021149-100
- Shipping:
- Calculated at Checkout
$638.00
Gene Name: MRPS30
Alternative Gene Name: PAP, PDCD9
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000021731: 91%, ENSRNOG00000012136: 94%
Entrez Gene ID: 10884
Uniprot ID: Q9NP92
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | WB, IHC |
| Reactivity | Human, Rat |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | FAWTGAQAMYQGFWSEADVTRPFVSQAVITDGKYFSFFCYQLNTLALTTQADQNNPRKNICWGTQSKPLYETIEDNDVKGFNDDVLLQIVHFLLNRP |
| Gene Sequence | FAWTGAQAMYQGFWSEADVTRPFVSQAVITDGKYFSFFCYQLNTLALTTQADQNNPRKNICWGTQSKPLYETIEDNDVKGFNDDVLLQIVHFLLNRP |
| Gene ID - Mouse | ENSMUSG00000021731 |
| Gene ID - Rat | ENSRNOG00000012136 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti MRPS30 pAb (ATL-HPA021149) | |
| Datasheet | Anti MRPS30 pAb (ATL-HPA021149) Datasheet (External Link) |
| Vendor Page | Anti MRPS30 pAb (ATL-HPA021149) at Atlas Antibodies |
| Documents & Links for Anti MRPS30 pAb (ATL-HPA021149) | |
| Datasheet | Anti MRPS30 pAb (ATL-HPA021149) Datasheet (External Link) |
| Vendor Page | Anti MRPS30 pAb (ATL-HPA021149) |