Anti MRPS30 pAb (ATL-HPA021149)

Atlas Antibodies

Catalog No.:
ATL-HPA021149-100
Shipping:
Calculated at Checkout
$638.00
Adding to cart… The item has been added
Protein Description: mitochondrial ribosomal protein S30
Gene Name: MRPS30
Alternative Gene Name: PAP, PDCD9
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000021731: 91%, ENSRNOG00000012136: 94%
Entrez Gene ID: 10884
Uniprot ID: Q9NP92
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, IHC
Reactivity Human, Rat
Clonality Polyclonal
Host Rabbit
Immunogen FAWTGAQAMYQGFWSEADVTRPFVSQAVITDGKYFSFFCYQLNTLALTTQADQNNPRKNICWGTQSKPLYETIEDNDVKGFNDDVLLQIVHFLLNRP
Gene Sequence FAWTGAQAMYQGFWSEADVTRPFVSQAVITDGKYFSFFCYQLNTLALTTQADQNNPRKNICWGTQSKPLYETIEDNDVKGFNDDVLLQIVHFLLNRP
Gene ID - Mouse ENSMUSG00000021731
Gene ID - Rat ENSRNOG00000012136
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti MRPS30 pAb (ATL-HPA021149)
Datasheet Anti MRPS30 pAb (ATL-HPA021149) Datasheet (External Link)
Vendor Page Anti MRPS30 pAb (ATL-HPA021149) at Atlas Antibodies

Documents & Links for Anti MRPS30 pAb (ATL-HPA021149)
Datasheet Anti MRPS30 pAb (ATL-HPA021149) Datasheet (External Link)
Vendor Page Anti MRPS30 pAb (ATL-HPA021149)