Anti MRPS27 pAb (ATL-HPA071751)

Atlas Antibodies

Catalog No.:
ATL-HPA071751-25
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: mitochondrial ribosomal protein S27
Gene Name: MRPS27
Alternative Gene Name: KIAA0264
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000041632: 75%, ENSRNOG00000017272: 79%
Entrez Gene ID: 23107
Uniprot ID: Q92552
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen FSSQLYGYALLGKVELQQGLRAVYHNMPLIWKPGYLDRALQVMEKVAASPEDIKLCREALDVLGAVLKALTSADGAS
Gene Sequence FSSQLYGYALLGKVELQQGLRAVYHNMPLIWKPGYLDRALQVMEKVAASPEDIKLCREALDVLGAVLKALTSADGAS
Gene ID - Mouse ENSMUSG00000041632
Gene ID - Rat ENSRNOG00000017272
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti MRPS27 pAb (ATL-HPA071751)
Datasheet Anti MRPS27 pAb (ATL-HPA071751) Datasheet (External Link)
Vendor Page Anti MRPS27 pAb (ATL-HPA071751) at Atlas Antibodies

Documents & Links for Anti MRPS27 pAb (ATL-HPA071751)
Datasheet Anti MRPS27 pAb (ATL-HPA071751) Datasheet (External Link)
Vendor Page Anti MRPS27 pAb (ATL-HPA071751)