Anti MRPS27 pAb (ATL-HPA071751)
Atlas Antibodies
- Catalog No.:
- ATL-HPA071751-25
- Shipping:
- Calculated at Checkout
$303.00
Gene Name: MRPS27
Alternative Gene Name: KIAA0264
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000041632: 75%, ENSRNOG00000017272: 79%
Entrez Gene ID: 23107
Uniprot ID: Q92552
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | WB, IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | FSSQLYGYALLGKVELQQGLRAVYHNMPLIWKPGYLDRALQVMEKVAASPEDIKLCREALDVLGAVLKALTSADGAS |
Gene Sequence | FSSQLYGYALLGKVELQQGLRAVYHNMPLIWKPGYLDRALQVMEKVAASPEDIKLCREALDVLGAVLKALTSADGAS |
Gene ID - Mouse | ENSMUSG00000041632 |
Gene ID - Rat | ENSRNOG00000017272 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti MRPS27 pAb (ATL-HPA071751) | |
Datasheet | Anti MRPS27 pAb (ATL-HPA071751) Datasheet (External Link) |
Vendor Page | Anti MRPS27 pAb (ATL-HPA071751) at Atlas Antibodies |
Documents & Links for Anti MRPS27 pAb (ATL-HPA071751) | |
Datasheet | Anti MRPS27 pAb (ATL-HPA071751) Datasheet (External Link) |
Vendor Page | Anti MRPS27 pAb (ATL-HPA071751) |