Anti MRPS26 pAb (ATL-HPA054610)

Atlas Antibodies

SKU: ATL-HPA054610-100

• 
• 

Protein Description: mitochondrial ribosomal protein S26
Gene Name: MRPS26
Alternative Gene Name: C20orf193, dJ534B8.3, MRP-S13, MRP-S26, RPMS13
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000037740: 59%, ENSRNOG00000021224: 62%
Entrez Gene ID: 64949
Uniprot ID: Q9BYN8
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: KALKDAAEHRELMAWNQAENRRLHELRIARLRQEEREQEQRQALEQARKAEEVQAWAQRKERE
• Gene Sequence: KALKDAAEHRELMAWNQAENRRLHELRIARLRQEEREQEQRQALEQARKAEEVQAWAQRKERE
• Gene ID - Mouse: ENSMUSG00000037740
• Gene ID - Rat: ENSRNOG00000021224
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.