Anti MRPS24 pAb (ATL-HPA073947)

Atlas Antibodies

Catalog No.: ATL-HPA073947-25

Protein Description: mitochondrial ribosomal protein S24
Gene Name: MRPS24
Alternative Gene Name: HSPC335, MRP-S24
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000020477: 91%, ENSRNOG00000011979: 91%
Entrez Gene ID: 64951
Uniprot ID: Q96EL2
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: PVCAKNRAARVRVSKGDKPVTYEEAHAPHYIAHRKGWLSLHTGNLDGEDHAAERTVEDVFLRKFMW
• Gene Sequence: PVCAKNRAARVRVSKGDKPVTYEEAHAPHYIAHRKGWLSLHTGNLDGEDHAAERTVEDVFLRKFMW
• Gene ID - Mouse: ENSMUSG00000020477
• Gene ID - Rat: ENSRNOG00000011979
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.