Anti MRPS24 pAb (ATL-HPA073947)
Atlas Antibodies
- Catalog No.:
- ATL-HPA073947-25
- Shipping:
- Calculated at Checkout
$478.00
Gene Name: MRPS24
Alternative Gene Name: HSPC335, MRP-S24
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000020477: 91%, ENSRNOG00000011979: 91%
Entrez Gene ID: 64951
Uniprot ID: Q96EL2
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | PVCAKNRAARVRVSKGDKPVTYEEAHAPHYIAHRKGWLSLHTGNLDGEDHAAERTVEDVFLRKFMW |
| Gene Sequence | PVCAKNRAARVRVSKGDKPVTYEEAHAPHYIAHRKGWLSLHTGNLDGEDHAAERTVEDVFLRKFMW |
| Gene ID - Mouse | ENSMUSG00000020477 |
| Gene ID - Rat | ENSRNOG00000011979 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti MRPS24 pAb (ATL-HPA073947) | |
| Datasheet | Anti MRPS24 pAb (ATL-HPA073947) Datasheet (External Link) |
| Vendor Page | Anti MRPS24 pAb (ATL-HPA073947) at Atlas Antibodies |
| Documents & Links for Anti MRPS24 pAb (ATL-HPA073947) | |
| Datasheet | Anti MRPS24 pAb (ATL-HPA073947) Datasheet (External Link) |
| Vendor Page | Anti MRPS24 pAb (ATL-HPA073947) |