Anti MRPS2 pAb (ATL-HPA057261)

Atlas Antibodies

Catalog No.: ATL-HPA057261-100

Protein Description: mitochondrial ribosomal protein S2
Gene Name: MRPS2
Alternative Gene Name: CGI-91
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000035772: 72%, ENSRNOG00000010164: 70%
Entrez Gene ID: 51116
Uniprot ID: Q9Y399
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: IFEPHVAVRDAAKMNIPTVGIVDTNCNPCLITYPVPGNDDSPLAVHLYCRLFQTAITRAKEKRQQVEALYRLQGQKEPGDQGPAHPPGAD
• Gene Sequence: IFEPHVAVRDAAKMNIPTVGIVDTNCNPCLITYPVPGNDDSPLAVHLYCRLFQTAITRAKEKRQQVEALYRLQGQKEPGDQGPAHPPGAD
• Gene ID - Mouse: ENSMUSG00000035772
• Gene ID - Rat: ENSRNOG00000010164
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.