Anti MRPS2 pAb (ATL-HPA057261)

Atlas Antibodies

Catalog No.:
ATL-HPA057261-100
Shipping:
Calculated at Checkout
$638.00
Adding to cart… The item has been added
Protein Description: mitochondrial ribosomal protein S2
Gene Name: MRPS2
Alternative Gene Name: CGI-91
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000035772: 72%, ENSRNOG00000010164: 70%
Entrez Gene ID: 51116
Uniprot ID: Q9Y399
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen IFEPHVAVRDAAKMNIPTVGIVDTNCNPCLITYPVPGNDDSPLAVHLYCRLFQTAITRAKEKRQQVEALYRLQGQKEPGDQGPAHPPGAD
Gene Sequence IFEPHVAVRDAAKMNIPTVGIVDTNCNPCLITYPVPGNDDSPLAVHLYCRLFQTAITRAKEKRQQVEALYRLQGQKEPGDQGPAHPPGAD
Gene ID - Mouse ENSMUSG00000035772
Gene ID - Rat ENSRNOG00000010164
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti MRPS2 pAb (ATL-HPA057261)
Datasheet Anti MRPS2 pAb (ATL-HPA057261) Datasheet (External Link)
Vendor Page Anti MRPS2 pAb (ATL-HPA057261) at Atlas Antibodies

Documents & Links for Anti MRPS2 pAb (ATL-HPA057261)
Datasheet Anti MRPS2 pAb (ATL-HPA057261) Datasheet (External Link)
Vendor Page Anti MRPS2 pAb (ATL-HPA057261)