Anti MRPS18C pAb (ATL-HPA050404)

Atlas Antibodies

Catalog No.:
ATL-HPA050404-25
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: mitochondrial ribosomal protein S18C
Gene Name: MRPS18C
Alternative Gene Name: CGI-134, FLJ11146, FLJ22967, MRPS18-1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000016833: 93%, ENSRNOG00000002178: 94%
Entrez Gene ID: 51023
Uniprot ID: Q9Y3D5
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen HVDYKNVQLLSQFVSPFTGCIYGRHITGLCGKKQKEITKAIKRAQIMGFMPVTYKDPAYLKDPKVCNIRYR
Gene Sequence HVDYKNVQLLSQFVSPFTGCIYGRHITGLCGKKQKEITKAIKRAQIMGFMPVTYKDPAYLKDPKVCNIRYR
Gene ID - Mouse ENSMUSG00000016833
Gene ID - Rat ENSRNOG00000002178
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti MRPS18C pAb (ATL-HPA050404)
Datasheet Anti MRPS18C pAb (ATL-HPA050404) Datasheet (External Link)
Vendor Page Anti MRPS18C pAb (ATL-HPA050404) at Atlas Antibodies

Documents & Links for Anti MRPS18C pAb (ATL-HPA050404)
Datasheet Anti MRPS18C pAb (ATL-HPA050404) Datasheet (External Link)
Vendor Page Anti MRPS18C pAb (ATL-HPA050404)