Anti MRPS15 pAb (ATL-HPA067137)

Atlas Antibodies

Catalog No.:
ATL-HPA067137-25
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: mitochondrial ribosomal protein S15
Gene Name: MRPS15
Alternative Gene Name: FLJ11564
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000028861: 77%, ENSRNOG00000008279: 76%
Entrez Gene ID: 64960
Uniprot ID: P82914
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen EQFMKKIVANPEDTRSLEARIIALSVKIRSYEEHLEKHRKDKAHKRYLLMSIDQRKKMLKNLRNTNYDVFE
Gene Sequence EQFMKKIVANPEDTRSLEARIIALSVKIRSYEEHLEKHRKDKAHKRYLLMSIDQRKKMLKNLRNTNYDVFE
Gene ID - Mouse ENSMUSG00000028861
Gene ID - Rat ENSRNOG00000008279
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti MRPS15 pAb (ATL-HPA067137)
Datasheet Anti MRPS15 pAb (ATL-HPA067137) Datasheet (External Link)
Vendor Page Anti MRPS15 pAb (ATL-HPA067137) at Atlas Antibodies

Documents & Links for Anti MRPS15 pAb (ATL-HPA067137)
Datasheet Anti MRPS15 pAb (ATL-HPA067137) Datasheet (External Link)
Vendor Page Anti MRPS15 pAb (ATL-HPA067137)