Anti MRPS12 pAb (ATL-HPA050633)

Atlas Antibodies

Catalog No.:
ATL-HPA050633-25
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: mitochondrial ribosomal protein S12
Gene Name: MRPS12
Alternative Gene Name: RPMS12, RPS12, RPSM12
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000045948: 91%, ENSRNOG00000019949: 91%
Entrez Gene ID: 6183
Uniprot ID: O15235
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen PQLKGVVLCTFTRKPKKPNSANRKCCRVRLSTGREAVCFIPGEGHTLQEHQIVLVEG
Gene Sequence PQLKGVVLCTFTRKPKKPNSANRKCCRVRLSTGREAVCFIPGEGHTLQEHQIVLVEG
Gene ID - Mouse ENSMUSG00000045948
Gene ID - Rat ENSRNOG00000019949
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti MRPS12 pAb (ATL-HPA050633)
Datasheet Anti MRPS12 pAb (ATL-HPA050633) Datasheet (External Link)
Vendor Page Anti MRPS12 pAb (ATL-HPA050633) at Atlas Antibodies

Documents & Links for Anti MRPS12 pAb (ATL-HPA050633)
Datasheet Anti MRPS12 pAb (ATL-HPA050633) Datasheet (External Link)
Vendor Page Anti MRPS12 pAb (ATL-HPA050633)