Anti MRPL52 pAb (ATL-HPA012319)

Atlas Antibodies

Catalog No.: ATL-HPA012319-25

Protein Description: mitochondrial ribosomal protein L52
Gene Name: MRPL52
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000010406: 85%, ENSRNOG00000039297: 85%
Entrez Gene ID: 122704
Uniprot ID: Q86TS9
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC, IHC
• Reactivity: Human, Mouse, Rat
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: QWRLQQGLAANPSGYGPLTELPDWSYADGRPAPPMKGQLRRKAERETFARRVVLLSQEMDAGLQAWQLRQQKLQEEQRKQENALKPKGASLKSPLPSQ
• Gene Sequence: QWRLQQGLAANPSGYGPLTELPDWSYADGRPAPPMKGQLRRKAERETFARRVVLLSQEMDAGLQAWQLRQQKLQEEQRKQENALKPKGASLKSPLPSQ
• Gene ID - Mouse: ENSMUSG00000010406
• Gene ID - Rat: ENSRNOG00000039297
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti MRPL52 pAb (ATL-HPA012319) – 1 Found

Martin, Timothy D; Cook, Danielle R; Choi, Mei Yuk; Li, Mamie Z; Haigis, Kevin M; Elledge, Stephen J. A Role for Mitochondrial Translation in Promotion of Viability in K-Ras Mutant Cells. Cell Reports. 2017;20(2):427-438.