Anti MRPL50 pAb (ATL-HPA056854)

Atlas Antibodies

Catalog No.: ATL-HPA056854-25

Protein Description: mitochondrial ribosomal protein L50
Gene Name: MRPL50
Alternative Gene Name: FLJ20493, MRP-L50
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000044018: 90%, ENSRNOG00000053615: 90%
Entrez Gene ID: 54534
Uniprot ID: Q8N5N7
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: LGHVVPNSRLHQMCRVRDVLDFYNVPIQDRSKFDELSASNLPPNLKITWS
• Gene Sequence: LGHVVPNSRLHQMCRVRDVLDFYNVPIQDRSKFDELSASNLPPNLKITWS
• Gene ID - Mouse: ENSMUSG00000044018
• Gene ID - Rat: ENSRNOG00000053615
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.