Anti MRPL50 pAb (ATL-HPA056854)

Atlas Antibodies

Catalog No.:
ATL-HPA056854-25
Shipping:
Calculated at Checkout
$478.00
Adding to cart… The item has been added
Protein Description: mitochondrial ribosomal protein L50
Gene Name: MRPL50
Alternative Gene Name: FLJ20493, MRP-L50
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000044018: 90%, ENSRNOG00000053615: 90%
Entrez Gene ID: 54534
Uniprot ID: Q8N5N7
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen LGHVVPNSRLHQMCRVRDVLDFYNVPIQDRSKFDELSASNLPPNLKITWS
Gene Sequence LGHVVPNSRLHQMCRVRDVLDFYNVPIQDRSKFDELSASNLPPNLKITWS
Gene ID - Mouse ENSMUSG00000044018
Gene ID - Rat ENSRNOG00000053615
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti MRPL50 pAb (ATL-HPA056854)
Datasheet Anti MRPL50 pAb (ATL-HPA056854) Datasheet (External Link)
Vendor Page Anti MRPL50 pAb (ATL-HPA056854) at Atlas Antibodies

Documents & Links for Anti MRPL50 pAb (ATL-HPA056854)
Datasheet Anti MRPL50 pAb (ATL-HPA056854) Datasheet (External Link)
Vendor Page Anti MRPL50 pAb (ATL-HPA056854)