Anti MRPL49 pAb (ATL-HPA046778)

Atlas Antibodies

Catalog No.:
ATL-HPA046778-25
Shipping:
Calculated at Checkout
$478.00
Adding to cart… The item has been added
Protein Description: mitochondrial ribosomal protein L49
Gene Name: MRPL49
Alternative Gene Name: C11orf4, L49mt, NOF, NOF1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000007338: 91%, ENSRNOG00000020975: 94%
Entrez Gene ID: 740
Uniprot ID: Q13405
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen GKTPVTQVNEVTGTLRIKGYFDQELKAWLLEKGF
Gene Sequence GKTPVTQVNEVTGTLRIKGYFDQELKAWLLEKGF
Gene ID - Mouse ENSMUSG00000007338
Gene ID - Rat ENSRNOG00000020975
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti MRPL49 pAb (ATL-HPA046778)
Datasheet Anti MRPL49 pAb (ATL-HPA046778) Datasheet (External Link)
Vendor Page Anti MRPL49 pAb (ATL-HPA046778) at Atlas Antibodies

Documents & Links for Anti MRPL49 pAb (ATL-HPA046778)
Datasheet Anti MRPL49 pAb (ATL-HPA046778) Datasheet (External Link)
Vendor Page Anti MRPL49 pAb (ATL-HPA046778)