Anti MRPL4 pAb (ATL-HPA051261)
Atlas Antibodies
- Catalog No.:
- ATL-HPA051261-25
- Shipping:
- Calculated at Checkout
$447.00
Gene Name: MRPL4
Alternative Gene Name: CGI-28
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000003299: 68%, ENSRNOG00000020659: 71%
Entrez Gene ID: 51073
Uniprot ID: Q9BYD3
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | WB, ICC, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | MLQFVRAGARAWLRPTGSQGLSSLAEEAARATENPEQVASEGLPEPVLRKVELPVPTHRRPVQAWVESLRGFEQERVGLADLHPDVFATAPRLDILHQVA |
| Gene Sequence | MLQFVRAGARAWLRPTGSQGLSSLAEEAARATENPEQVASEGLPEPVLRKVELPVPTHRRPVQAWVESLRGFEQERVGLADLHPDVFATAPRLDILHQVA |
| Gene ID - Mouse | ENSMUSG00000003299 |
| Gene ID - Rat | ENSRNOG00000020659 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti MRPL4 pAb (ATL-HPA051261) | |
| Datasheet | Anti MRPL4 pAb (ATL-HPA051261) Datasheet (External Link) |
| Vendor Page | Anti MRPL4 pAb (ATL-HPA051261) at Atlas Antibodies |
| Documents & Links for Anti MRPL4 pAb (ATL-HPA051261) | |
| Datasheet | Anti MRPL4 pAb (ATL-HPA051261) Datasheet (External Link) |
| Vendor Page | Anti MRPL4 pAb (ATL-HPA051261) |
| Citations for Anti MRPL4 pAb (ATL-HPA051261) – 1 Found |
| Abshire, Elizabeth T; Hughes, Kelsey L; Diao, Rucheng; Pearce, Sarah; Gopalakrishna, Shreekara; Trievel, Raymond C; Rorbach, Joanna; Freddolino, Peter L; Goldstrohm, Aaron C. Differential processing and localization of human Nocturnin controls metabolism of mRNA and nicotinamide adenine dinucleotide cofactors. The Journal Of Biological Chemistry. 2020;295(44):15112-15133. PubMed |