Anti MRPL37 pAb (ATL-HPA025951)

Atlas Antibodies

Catalog No.: ATL-HPA025951-25

Protein Description: mitochondrial ribosomal protein L37
Gene Name: MRPL37
Alternative Gene Name: MRP-L2, RPML2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000028622: 84%, ENSRNOG00000009078: 81%
Entrez Gene ID: 51253
Uniprot ID: Q9BZE1
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: LTKTKLIEGLPEKVLSLVDDPRNHIENQDECVLNVISHARLWQTTEEIPKRETYCPVIVDNLIQLCKSQILKHP
• Gene Sequence: LTKTKLIEGLPEKVLSLVDDPRNHIENQDECVLNVISHARLWQTTEEIPKRETYCPVIVDNLIQLCKSQILKHP
• Gene ID - Mouse: ENSMUSG00000028622
• Gene ID - Rat: ENSRNOG00000009078
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti MRPL37 pAb (ATL-HPA025951) – 1 Found

Danielsson, Frida; Wiking, Mikaela; Mahdessian, Diana; Skogs, Marie; Ait Blal, Hammou; Hjelmare, Martin; Stadler, Charlotte; Uhlén, Mathias; Lundberg, Emma. RNA deep sequencing as a tool for selection of cell lines for systematic subcellular localization of all human proteins. Journal Of Proteome Research. 2013;12(1):299-307.